DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3224 and Zfp593

DIOPT Version :9

Sequence 1:NP_572335.1 Gene:CG3224 / 31600 FlyBaseID:FBgn0029885 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001100159.1 Gene:Zfp593 / 298546 RGDID:1310179 Length:134 Species:Rattus norvegicus


Alignment Length:142 Identity:57/142 - (40%)
Similarity:80/142 - (56%) Gaps:18/142 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SKRKKMHYGDTHLQRRWRVRNRRRDLDQIDDDLQ----TRSGELINQNVDLDKPGFAQFYCVHCA 65
            |:|...|...: |.|:.:.:.||.|||:|..:|:    .|.....:...|.|.||.....|:.||
  Rat     4 SRRTGAHRAHS-LARQMKAKKRRPDLDEIHRELRPQALPRPKRERDAEPDPDLPGGGLHRCLACA 67

  Fly    66 KYFIDDTAMQAHFRTKVHKRRLKALEIEPYSIEEAERAAGRGSFVKPKKRAMETQPSKEDVVAGK 130
            :||||...::.|||:|.||:|||.|.:||||.||||||||.||:|:|::..:.|:.|.|      
  Rat    68 RYFIDSANLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYVQPQRLGVPTEVSTE------ 126

  Fly   131 RIRVEVVPE-DT 141
                  :|| ||
  Rat   127 ------IPEMDT 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3224NP_572335.1 UFD2 <49..119 CDD:227443 37/69 (54%)
Zfp593NP_001100159.1 UFD2 1..108 CDD:227443 45/104 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338802
Domainoid 1 1.000 50 1.000 Domainoid score I11434
eggNOG 1 0.900 - - E1_COG5112
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41070
Inparanoid 1 1.050 96 1.000 Inparanoid score I4953
OMA 1 1.010 - - QHG54265
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003984
OrthoInspector 1 1.000 - - oto97912
orthoMCL 1 0.900 - - OOG6_103042
Panther 1 1.100 - - LDO PTHR46095
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2745
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.760

Return to query results.
Submit another query.