DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3224 and SPAC19B12.11c

DIOPT Version :9

Sequence 1:NP_572335.1 Gene:CG3224 / 31600 FlyBaseID:FBgn0029885 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_594774.1 Gene:SPAC19B12.11c / 2542462 PomBaseID:SPAC19B12.11c Length:124 Species:Schizosaccharomyces pombe


Alignment Length:127 Identity:54/127 - (42%)
Similarity:69/127 - (54%) Gaps:6/127 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGMVSKRKKMHYGDTHLQRRWRVRNRRRDLDQIDDDLQTRSGELINQNVDLDKPGFAQFYCVHCA 65
            ||.|::::|.|....|...|.||..  ||||||.:|| |.|.:.....:|.|.||..|.||:.||
pombe     1 MGRVARKRKHHSNGNHALFRTRVYG--RDLDQIHNDL-TESEKFDKLPIDPDLPGLGQHYCIECA 62

  Fly    66 KYFIDDTAMQAHFRTKVHKRRLKALEIEPYSIEEAERAAGRGSFVKPKKRAMETQPSKEDVV 127
            :||....|:..|.:.||||||||.|..|||:.||||.|...|   :||:..........:||
pombe    63 RYFDSSQALLVHKKGKVHKRRLKNLREEPYTQEEAEAAVNIG---QPKQSVASKLADNSNVV 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3224NP_572335.1 UFD2 <49..119 CDD:227443 33/69 (48%)
SPAC19B12.11cNP_594774.1 UFD2 1..124 CDD:227443 54/127 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5112
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 90 1.000 Inparanoid score I1753
OMA 1 1.010 - - QHG54265
OrthoFinder 1 1.000 - - FOG0003984
OrthoInspector 1 1.000 - - oto101691
orthoMCL 1 0.900 - - OOG6_103042
Panther 1 1.100 - - LDO PTHR46095
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R155
SonicParanoid 1 1.000 - - X2745
TreeFam 1 0.960 - -
1211.860

Return to query results.
Submit another query.