DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc7 and CG12147

DIOPT Version :9

Sequence 1:NP_727103.1 Gene:Cdc7 / 31598 FlyBaseID:FBgn0028360 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_649536.1 Gene:CG12147 / 40651 FlyBaseID:FBgn0037325 Length:477 Species:Drosophila melanogaster


Alignment Length:386 Identity:75/386 - (19%)
Similarity:136/386 - (35%) Gaps:123/386 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 PATPRTTKQARNKSEEAINDLLTRIPDI---GKLFDVHSRIGNGTF------------------- 138
            |..|....:...:.:...::....:|:|   || :.:..|||||:|                   
  Fly    35 PPQPNHPHEKDQRQDRRFSEEKQSLPEIIVAGK-YRLLKRIGNGSFGELFQAEGLKYHEKVAIKL 98

  Fly   139 --STVLLGTLRRESHLPDSLRRKFAIKH--HIPTSHPDRIMKELQCMTKMGGK-ENVVGIHCCMR 198
              |||....|.||:.:...|:....|.|  |..|.....:|    .|..:|.. |:::.:  |.|
  Fly    99 ESSTVKHPLLPREARIYGILQGGLGIPHVKHYATEGAYNVM----VMDLLGPTLEDLLNL--CSR 157

  Fly   199 YDASAAFVMPFMAHDRFQDFYTRMDVPEIRQYMRNLLVALRHVHKFDVIHRDVKPSNFL--YNRR 261
               |.:.....|..|:                   :|..:..:|:...||||:||.|||  .||.
  Fly   158 ---SFSMKTTLMLADQ-------------------ILARVELLHRRCFIHRDIKPDNFLMGLNRH 200

  Fly   262 RREFLLVDFGLA---------QHVNPPAARSSGSAAAIAAANNKNNNNNNNNNSKRPRERESKGD 317
            :.:..::|||||         :|:.....|.....|..|:..            ....|:..:.|
  Fly   201 QTQVYMIDFGLAKKFYSLRTQKHIGYTENRDLVGTARYASVR------------AHYAEQSRRDD 253

  Fly   318 VQQIALDAGLGGAVKRMRLHEESNKMPLKPVNDIAPSDA-------------PEQSVDGSNHVQP 369
            ::.:..          :.|:.:..::|.:.:.  |.|.|             |.|.:.....|:.
  Fly   254 LESVGY----------LLLYFQRGRLPWQGIR--AQSQAQKYEKIAEYKANIPLQQLCSGLPVEF 306

  Fly   370 QLVQQEQQQLQPQQQQQQQQQQQ------QSQ-------------QQQQPQQQSQQQHPQR 411
            .:..:..::|...::......||      ::|             :::.|:|||||:..:|
  Fly   307 FMYLKYCRKLHFAEKPDYVYLQQLFKVLFRNQYKVCDFLFDWVVLKRESPEQQSQQKGRER 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc7NP_727103.1 STKc_Cdc7 125..644 CDD:270921 70/354 (20%)
PKc_like <474..644 CDD:304357
PKc_like <616..675 CDD:304357
CG12147NP_649536.1 STKc_CK1 67..331 CDD:270918 62/316 (20%)
SPS1 67..>306 CDD:223589 59/291 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452721
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11909
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.