DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc7 and CkIalpha

DIOPT Version :9

Sequence 1:NP_727103.1 Gene:Cdc7 / 31598 FlyBaseID:FBgn0028360 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster


Alignment Length:335 Identity:72/335 - (21%)
Similarity:122/335 - (36%) Gaps:49/335 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 IGKLFDVHSRIGNGTFSTVLLGTLRRESHLPDSLRRKFAIK-HHIPTSHPDRIMKELQCMTKMGG 186
            :|..:.|..:||:|:|..:.||...:..       .:.||| ......||..:.:........||
  Fly    16 VGGKYRVIRKIGSGSFGDIYLGMSIQSG-------EEVAIKMESAHARHPQLLYEAKLYRILSGG 73

  Fly   187 KENVVGIHCCMRYDASAAF---VMPFMA---HDRFQDFYTR-MDVPEIRQYMRNLLVALRHVHKF 244
                ||......:.....|   ||..:.   .|.| :|.|| ..:..:...:..::..|.::|..
  Fly    74 ----VGFPRIRHHGKEKNFNTLVMDLLGPSLEDLF-NFCTRHFTIKTVLMLVDQMIGRLEYIHLK 133

  Fly   245 DVIHRDVKPSNFL--YNRRRREFLLVDFGLAQHVNPPAARSSGSAAAIAAANNKN---------- 297
            ..||||:||.|||  ..|...:..|:|||||:....|..|..     |....:||          
  Fly   134 CFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKFRDPHTRHH-----IVYREDKNLTGTARYASI 193

  Fly   298 NNNNNNNNSKRPRERESKGDVQQ-----IALDAGLGGAVKRMRLHEESNKMPLKPVNDIAPSDAP 357
            |.:.....|:|. :.||.|.|..     :....|:....|:.:..:.|.|....|:..:......
  Fly   194 NAHLGIEQSRRD-DMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSPA 257

  Fly   358 EQSVDGSNHVQPQLVQQEQQQLQPQQQ-----QQQQQQQQQSQQQQQPQQQSQQQHPQRQPQLAQ 417
            |.|: ..|:.:....:::...:..:|.     :....|..........:|::.|..|.....|.|
  Fly   258 EFSM-YLNYCRSLRFEEQPDYMYLRQLFRILFRTLNHQYDYIYDWTMLKQKTHQGQPNPAILLEQ 321

  Fly   418 MDQTASTPSG 427
            :|:.....:|
  Fly   322 LDKDKEKQNG 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc7NP_727103.1 STKc_Cdc7 125..644 CDD:270921 71/333 (21%)
PKc_like <474..644 CDD:304357
PKc_like <616..675 CDD:304357
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 63/283 (22%)
Pkinase_Tyr 23..284 CDD:285015 62/279 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452725
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11909
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.