DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3226 and SGT1

DIOPT Version :9

Sequence 1:NP_572332.1 Gene:CG3226 / 31597 FlyBaseID:FBgn0029882 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_014700.1 Gene:SGT1 / 854222 SGDID:S000005583 Length:395 Species:Saccharomyces cerevisiae


Alignment Length:185 Identity:42/185 - (22%)
Similarity:73/185 - (39%) Gaps:47/185 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 WDQSAKFVKL-FITLNGVQGCTEENVTVTYTPN-----SLQLHVRDLQGKDFGLTVNNLLHSIDV 131
            |.||:..|.: ..|:|..:  ::|.|.:..:||     |:...| ...|.:|.... .|.|.:|.
Yeast   189 WYQSSTSVTISLFTVNLPE--SKEQVNIYISPNDRRTLSISYQV-PKSGSEFQYNA-KLSHEVDP 249

  Fly   132 EKSYRKIKTDMVAIYLQKVEDKHW-----DVL-----------------------TAIQKRL--- 165
            :....||....:.|.|.|::...|     |:|                       ||.::||   
Yeast   250 KAVSLKIFPKKLEITLSKIDSTQWKKLEEDILTESSRLSDEGKNSDSATRLLSAETASKERLSYP 314

  Fly   166 ---KQKKD---SELSKDGDNPESALVNIMKKMYNDGDSKTKQMIAKAWTESQDKA 214
               |:|.|   .::.::.|....:..:..:|:|...|..||:.:.|::.||...|
Yeast   315 SSSKKKIDWSKLDIDEEADEEAGSADSFFQKLYAGADPDTKRAMMKSFIESNGTA 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3226NP_572332.1 Siah-Interact_N 3..>60 CDD:286164
p23_CacyBP 68..159 CDD:107225 25/119 (21%)
SGT1NP_014700.1 SGT1 10..395 CDD:227422 42/185 (23%)
TPR repeat 37..77 CDD:276809
TPR repeat 82..114 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.