Sequence 1: | NP_572332.1 | Gene: | CG3226 / 31597 | FlyBaseID: | FBgn0029882 | Length: | 230 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001013069.1 | Gene: | Sugt1 / 290408 | RGDID: | 1307550 | Length: | 336 | Species: | Rattus norvegicus |
Alignment Length: | 223 | Identity: | 51/223 - (22%) |
---|---|---|---|
Similarity: | 94/223 - (42%) | Gaps: | 47/223 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 KDVLTTAKAEAEREIV-----NLELKAKIAAERQATGSSE--AKRYLHELTDYGWDQSAKFVKLF 83
Fly 84 ITLNGVQGCTEENVTVTYTPNSLQLHVRDLQGKDFGLTVNNLLHSIDVEKSYRKIKTDMVAIYLQ 148
Fly 149 KVEDKHWDVL------------TAIQKRL-------------------KQKKDSELSKDGDNPES 182
Fly 183 ALVNIMKKMYNDGDSKTKQMIAKAWTES 210 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3226 | NP_572332.1 | Siah-Interact_N | 3..>60 | CDD:286164 | 8/38 (21%) |
p23_CacyBP | 68..159 | CDD:107225 | 25/102 (25%) | ||
Sugt1 | NP_001013069.1 | TPR 1 | 11..44 | ||
PLN03088 | 21..336 | CDD:215568 | 51/223 (23%) | ||
TPR repeat | 44..74 | CDD:276809 | |||
TPR 2 | 45..78 | ||||
TPR | 45..78 | CDD:197478 | |||
TPR 3 | 79..112 | 4/18 (22%) | |||
TPR repeat | 79..107 | CDD:276809 | 4/13 (31%) | ||
p23_CS_hSgt1_like | 146..229 | CDD:107239 | 23/86 (27%) | ||
SGS | 256..336 | CDD:282811 | 13/56 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |