DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3226 and Sugt1

DIOPT Version :9

Sequence 1:NP_572332.1 Gene:CG3226 / 31597 FlyBaseID:FBgn0029882 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001013069.1 Gene:Sugt1 / 290408 RGDID:1307550 Length:336 Species:Rattus norvegicus


Alignment Length:223 Identity:51/223 - (22%)
Similarity:94/223 - (42%) Gaps:47/223 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KDVLTTAKAEAEREIV-----NLELKAKIAAERQATGSSE--AKRYLHELTDYGWDQSAKFVKLF 83
            ||..:..:..||.:.:     |.::..|...|.|.....|  |.:.......|.|.|:...|.:.
  Rat    93 KDYASALETFAEGQKLDGTDTNFDIWIKRCQEIQNGSEPEVSASQRTQSKIKYDWYQTESHVIIT 157

  Fly    84 ITLNGVQGCTEENVTVTYTPNSLQLHVRDLQGKDFGLTVNNLLHSIDVEKSYRKIKTDMVAIYLQ 148
            :.:..||   :.:|.|.::...|...|:...|:|..|.: .|||.|..|:|..|:.:..:.|.::
  Rat   158 LMIKNVQ---KNDVRVDFSEKELSAVVKIPSGEDCSLKL-RLLHPIIPEQSTFKVLSTKIEIKMK 218

  Fly   149 KVEDKHWDVL------------TAIQKRL-------------------KQKKDSELSKDGDNPES 182
            |.|...|:.|            ||..|.:                   :::|:.:|  :||   :
  Rat   219 KPEAVRWEKLEGQGDVPAPKQFTADVKNMYPSSSHYTRNWDKLVGEIKEEEKNEKL--EGD---A 278

  Fly   183 ALVNIMKKMYNDGDSKTKQMIAKAWTES 210
            ||..:.:::|:||..:.|:.:.|::.||
  Rat   279 ALNKLFQQIYSDGSDEVKRAMNKSFMES 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3226NP_572332.1 Siah-Interact_N 3..>60 CDD:286164 8/38 (21%)
p23_CacyBP 68..159 CDD:107225 25/102 (25%)
Sugt1NP_001013069.1 TPR 1 11..44
PLN03088 21..336 CDD:215568 51/223 (23%)
TPR repeat 44..74 CDD:276809
TPR 2 45..78
TPR 45..78 CDD:197478
TPR 3 79..112 4/18 (22%)
TPR repeat 79..107 CDD:276809 4/13 (31%)
p23_CS_hSgt1_like 146..229 CDD:107239 23/86 (27%)
SGS 256..336 CDD:282811 13/56 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.