DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3226 and Cacybp

DIOPT Version :9

Sequence 1:NP_572332.1 Gene:CG3226 / 31597 FlyBaseID:FBgn0029882 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001004208.1 Gene:Cacybp / 289144 RGDID:1303146 Length:229 Species:Rattus norvegicus


Alignment Length:225 Identity:88/225 - (39%)
Similarity:132/225 - (58%) Gaps:20/225 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLEQLKSDVAELAAFLQQAKGARVKDVLTTAKAEAEREIVN-----LELKAKIAAERQA------ 55
            :||:|:.|:.|:...|:::...|::|.||..|::.|.|:.|     .:.|.:...|:.|      
  Rat     4 ALEELQKDLEEVKVLLEKSTRKRLRDTLTNEKSKIETELRNKMQQKSQKKPEFDNEKPAAVVAPL 68

  Fly    56 -TGSSEAKRYLHELTDYGWDQSAKFVKLFITLNGVQGCTEENVTVTYTPNSLQLHVRDLQGKDFG 119
             ||      |..::::||||||.||||::|||.||.....|||.|.:|..|..|.|::|.||::.
  Rat    69 TTG------YTVKISNYGWDQSDKFVKIYITLTGVHQVPAENVQVHFTERSFDLLVKNLNGKNYS 127

  Fly   120 LTVNNLLHSIDVEKSYRKIKTDMVAIYL-QKVEDKHWDVLTAIQKRLKQKKDSELSKDGDNPESA 183
            :.|||||..|.||.|.:|:|||.|.|.. :|.|:..||.||.::|..|:|:......:.| |...
  Rat   128 MIVNNLLKPISVESSSKKVKTDTVIILCRKKAENTRWDYLTQVEKECKEKEKPSYDTEAD-PSEG 191

  Fly   184 LVNIMKKMYNDGDSKTKQMIAKAWTESQDK 213
            |:|::||:|.|||...|:.|.|||.||::|
  Rat   192 LMNVLKKIYEDGDDDMKRTINKAWVESREK 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3226NP_572332.1 Siah-Interact_N 3..>60 CDD:286164 19/68 (28%)
p23_CacyBP 68..159 CDD:107225 45/91 (49%)
CacybpNP_001004208.1 Interaction with SIAH1. /evidence=ECO:0000250 2..81 21/82 (26%)
Siah-Interact_N 5..76 CDD:401103 20/76 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..59 4/20 (20%)
Interaction with SKP1. /evidence=ECO:0000250 74..229 68/149 (46%)
p23_CacyBP 76..168 CDD:107225 45/91 (49%)
Interaction with S100A6. /evidence=ECO:0000250 155..229 27/68 (40%)
SGS 183..>218 CDD:398600 15/35 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353139
Domainoid 1 1.000 85 1.000 Domainoid score I8037
eggNOG 1 0.900 - - E1_KOG3260
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7649
Inparanoid 1 1.050 157 1.000 Inparanoid score I4197
OMA 1 1.010 - - QHG57296
OrthoDB 1 1.010 - - D1181437at2759
OrthoFinder 1 1.000 - - FOG0007452
OrthoInspector 1 1.000 - - oto97805
orthoMCL 1 0.900 - - OOG6_104999
Panther 1 1.100 - - LDO PTHR13164
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5581
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.