DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3226 and CACYBP

DIOPT Version :9

Sequence 1:NP_572332.1 Gene:CG3226 / 31597 FlyBaseID:FBgn0029882 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_055227.1 Gene:CACYBP / 27101 HGNCID:30423 Length:228 Species:Homo sapiens


Alignment Length:225 Identity:92/225 - (40%)
Similarity:134/225 - (59%) Gaps:9/225 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLEQLKSDVAELAAFLQQAKGARVKDVLTTAKAEAEREIVN-LELKAKIAAE------RQATGS 58
            |:.|:|:.|:.|:...|::|...||:|.||..|::.|.||.| ::.|::..||      ..|..:
Human     1 MASEELQKDLEEVKVLLEKATRKRVRDALTAEKSKIETEIKNKMQQKSQKKAELLDNEKPAAVVA 65

  Fly    59 SEAKRYLHELTDYGWDQSAKFVKLFITLNGVQGCTEENVTVTYTPNSLQLHVRDLQGKDFGLTVN 123
            .....|..::::||||||.||||::|||.||.....|||.|.:|..|..|.|::|.||.:.:.||
Human    66 PITTGYTVKISNYGWDQSDKFVKIYITLTGVHQVPTENVQVHFTERSFDLLVKNLNGKSYSMIVN 130

  Fly   124 NLLHSIDVEKSYRKIKTDMVAIYL-QKVEDKHWDVLTAIQKRLKQKKDSELSKDGDNPESALVNI 187
            |||..|.||.|.:|:|||.|.|.. :|||:..||.||.::|..|:|:......:.| |...|:|:
Human   131 NLLKPISVEGSSKKVKTDTVLILCRKKVENTRWDYLTQVEKECKEKEKPSYDTETD-PSEGLMNV 194

  Fly   188 MKKMYNDGDSKTKQMIAKAWTESQDKAKLG 217
            :||:|.|||...|:.|.|||.||::|...|
Human   195 LKKIYEDGDDDMKRTINKAWVESREKQAKG 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3226NP_572332.1 Siah-Interact_N 3..>60 CDD:286164 20/63 (32%)
p23_CacyBP 68..159 CDD:107225 46/91 (51%)
CACYBPNP_055227.1 Interaction with SIAH1 2..80 22/77 (29%)
Siah-Interact_N 4..75 CDD:401103 21/70 (30%)
Interaction with SKP1. /evidence=ECO:0000269|PubMed:11389839 73..228 70/153 (46%)
p23_CacyBP 75..167 CDD:107225 46/91 (51%)
Interaction with S100A6. /evidence=ECO:0000250 154..228 29/72 (40%)
SGS 182..>217 CDD:398600 15/35 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159127
Domainoid 1 1.000 84 1.000 Domainoid score I8310
eggNOG 1 0.900 - - E1_KOG3260
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7649
Inparanoid 1 1.050 162 1.000 Inparanoid score I4227
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57296
OrthoDB 1 1.010 - - D1181437at2759
OrthoFinder 1 1.000 - - FOG0007452
OrthoInspector 1 1.000 - - oto90700
orthoMCL 1 0.900 - - OOG6_104999
Panther 1 1.100 - - LDO PTHR13164
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5835
SonicParanoid 1 1.000 - - X5581
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.