DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pigs and EVPLL

DIOPT Version :9

Sequence 1:NP_001245550.1 Gene:pigs / 31596 FlyBaseID:FBgn0029881 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_001138599.1 Gene:EVPLL / 645027 HGNCID:35236 Length:301 Species:Homo sapiens


Alignment Length:231 Identity:43/231 - (18%)
Similarity:70/231 - (30%) Gaps:78/231 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   594 AEKATTDILEEEDLNGQDREEDQEDYSVCDGPQSLPAILSGAHKLSDKFEQSGVFITDDEITVDI 658
            |::...||||.:....|||...::..:           |....:.....:::.|.:.|..:.||.
Human     5 ADQVERDILETQKRLQQDRLNSEQSQA-----------LQHQQETGSSLKEAEVLLKDLFLDVDK 58

  Fly   659 AKTEDQSVANTMGNPTPNLSKIPRSPLAQRRRRSIDNSTCGGAGGSLQDLSSRSGLPAPAFSRKQ 723
            |:.                   .:.|.|:...:.|:         .|.:..::......|...|.
Human    59 ARR-------------------LKHPQAEETEKDIE---------QLHERVTQECAEYCALYEKM 95

  Fly   724 PVYRSVRTRNSTGATTTPVAPPRSRQATQLPMVRDVTNTWSGRTTGAPKRRPPCTADTFVAPTNG 788
                              |.|||..       ::....|.:|..|.|..|||...         |
Human    96 ------------------VLPPRRG-------IQGRLGTRAGAETEAGLRRPVWA---------G 126

  Fly   789 TGPAGSFERNGKGRSSQILYDSNGRRVRS--GAPGC 822
            .|.||..:|..:.|:..   |...||..:  |..||
Human   127 HGGAGGTDRGAQHRAEG---DQRPRRAAAEPGGAGC 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pigsNP_001245550.1 CH 22..159 CDD:237981
GAS2 258..325 CDD:280367
EVPLLNP_001138599.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..41 4/33 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..166 15/54 (28%)
SPEC 193..>292 CDD:295325
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.