DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pigs and gas2b

DIOPT Version :9

Sequence 1:NP_001245550.1 Gene:pigs / 31596 FlyBaseID:FBgn0029881 Length:977 Species:Drosophila melanogaster
Sequence 2:XP_002662883.1 Gene:gas2b / 567205 ZFINID:ZDB-GENE-030616-552 Length:393 Species:Danio rerio


Alignment Length:385 Identity:121/385 - (31%)
Similarity:181/385 - (47%) Gaps:79/385 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EEYLEAMREDLAEWLSTLYPELSINADNFMDRLDTGVALCKHANYVRQAAVDYLARRQARNKSMT 80
            |..|..|::|||.||:.:. .|.|..|.||||||.||.||:.|..:::..:  ||   :..|.:.
Zfish    30 ESSLLPMKDDLALWLNRIL-GLDITVDTFMDRLDNGVVLCQLAEALQEKMI--LA---SNGKPII 88

  Fly    81 RSMTSGLAGPILAMGNVHYLPAAKSGTFFARDNVSNFITWCRKSLKIIECLLFETDDLIMRKNEK 145
            |.:             :.:.|.|.||:||||||.:||:.|||| :.:.:..|||::||:::|:.:
Zfish    89 RRV-------------IRWRPDAASGSFFARDNTANFLYWCRK-IGVEQSHLFESEDLVLQKHPR 139

  Fly   146 HVILCLLEVARRGAKFGMLAPMLVQMERQIDREIAADIKANGAGCS------------------- 191
            .|.|||:::.|..:::|:..|.||::||:|::|.......:....|                   
Zfish   140 DVCLCLMQLGRIASRYGIEPPALVKLEREIEKEEDESSSPSMLFASPLPSPSTPPVFFPADPLEP 204

  Fly   192 ENGTQTDALETGNSSAATMTTITTTTVETDLYDDSDDS-------ETEDDGDQNPVLMYGPQPQ- 248
            ..|.:..::....||.:.....|.......:..|.:..       .|.....:.||....|.|. 
Zfish   205 PPGLRPSSISPPASSPSPPLVPTPPPESASIISDPNTHPEPQPTIPTNSSPIKTPVKSTLPSPTN 269

  Fly   249 --IITNDLKS----LDEMVRDLVE--KCTCPSQFPMVRVSEGKYRIGDTKVLIFVRILR-SHVMV 304
              ..||..||    ||::||.:.|  .|.||.:|.:.:..:|.||:|| ||| :||:|. .|.||
Zfish   270 GFAKTNKRKSSGNLLDDIVRQISEDPPCKCPVKFCIEKQPKGHYRVGD-KVL-YVRMLNDKHAMV 332

  Fly   305 RVGGGWDTLSHYLDKHDPCRCRAQHRSSVAARLIPRQSPNHNPSNGIELHKAQVIFERSP 364
            ||||||:....||.||||||          ..:|.|..|..:..||           |||
Zfish   333 RVGGGWEPFGTYLLKHDPCR----------MTMIARPGPKSSKPNG-----------RSP 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pigsNP_001245550.1 CH 22..159 CDD:237981 51/136 (38%)
GAS2 258..325 CDD:280367 35/69 (51%)
gas2bXP_002662883.1 CH 35..152 CDD:237981 51/136 (38%)
GAS2 282..353 CDD:295345 37/82 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343422at2759
OrthoFinder 1 1.000 - - FOG0001647
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.