DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pigs and gas2

DIOPT Version :9

Sequence 1:NP_001245550.1 Gene:pigs / 31596 FlyBaseID:FBgn0029881 Length:977 Species:Drosophila melanogaster
Sequence 2:XP_685440.4 Gene:gas2 / 557312 -ID:- Length:334 Species:Danio rerio


Alignment Length:340 Identity:110/340 - (32%)
Similarity:175/340 - (51%) Gaps:67/340 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EEYLEAMREDLAEWLSTLYPELSINADNFMDRLDTGVALCKHANYVRQAAVDYLARRQARNKSMT 80
            |..|..|:||||.|||::. .:.|:|::||:|||.|..||:.|..:           |.:.:..:
Zfish    31 EASLLPMKEDLALWLSSML-GVEISAESFMERLDNGFLLCRLAETL-----------QEKFRENS 83

  Fly    81 RSMTSGLAGPILAMGNVHYLPAAKSGTFFARDNVSNFITWCRKSLKIIECLLFETDDLIMRKNEK 145
            ..:||  .|..:....:....:|.|||||||||.:||::|||: :.:.|..|||:|.|::.|.::
Zfish    84 SDVTS--PGKSIPCRRIPCRASAASGTFFARDNTANFLSWCRE-VGVGETCLFESDGLVLHKQQR 145

  Fly   146 HVILCLLEVARRGAKFGMLAPMLVQMERQIDREIAADIK--------ANGAGCSENGTQTDALET 202
            .|.|||||:.|..|::.:..|.|:::|::|::|   :.|        ...|..|::...:.::..
Zfish   146 EVCLCLLELGRIAARYKVEPPGLIKLEKEIEQE---EEKLPEPPLSPVTPASYSQSPPVSPSISP 207

  Fly   203 GNSSAATMTTITTTTVETDLYDDSDDSETEDDGDQNPVLMYGPQPQIITNDLKSLDEMVRDLVE- 266
            .||.                ::.|:.|:....                    |.|||.|:.:.| 
Zfish   208 SNSP----------------FNKSNSSKKSTG--------------------KLLDEAVKHISED 236

  Fly   267 -KCTCPSQFPMVRVSEGKYRIGDTKVLIFVRILRS-HVMVRVGGGWDTLSHYLDKHDPCRCRAQH 329
             .|.||::|.:.|.|:|:||:|:.  ::|:|:|.: ||||||||||:|...||.||||||.....
Zfish   237 PPCKCPNKFCIERQSQGRYRVGEK--MLFIRMLHNKHVMVRVGGGWETFESYLLKHDPCRMLQIS 299

  Fly   330 RSSVAARLIPRQSPN 344
            |.......|..:|||
Zfish   300 RVEGKISPISGKSPN 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pigsNP_001245550.1 CH 22..159 CDD:237981 52/136 (38%)
GAS2 258..325 CDD:280367 35/69 (51%)
gas2XP_685440.4 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343422at2759
OrthoFinder 1 1.000 - - FOG0001647
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.