DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pigs and Gas2

DIOPT Version :9

Sequence 1:NP_001245550.1 Gene:pigs / 31596 FlyBaseID:FBgn0029881 Length:977 Species:Drosophila melanogaster
Sequence 2:XP_006229335.1 Gene:Gas2 / 499156 RGDID:1563167 Length:332 Species:Rattus norvegicus


Alignment Length:356 Identity:108/356 - (30%)
Similarity:163/356 - (45%) Gaps:91/356 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EEYLEAMREDLAEWLSTLYPELSINADNFMDRLDTGVALCKHANYVRQAAVDYLARRQARNKSMT 80
            |..|..|:||||.||:.|..: .|.|:.||::||.|..||:.|..|::              ...
  Rat    31 EANLLPMKEDLALWLTNLLGK-EITAETFMEKLDNGALLCQLAATVQE--------------KFK 80

  Fly    81 RSMTSGLAGPILAMGNVHYLPAAKSGTFFARDNVSNFITWCRKSLKIIECLLFETDDLIMRKNEK 145
            .||.:......|.:..:....:|.||:||||||.:||::||| .|.:.|..|||::.|::.|..:
  Rat    81 ESMDTNKPAKTLPLKKIPCKASAPSGSFFARDNTANFLSWCR-DLGVDETCLFESEGLVLHKQPR 144

  Fly   146 HVILCLLEVARRGAKFGMLAPMLVQMERQIDREIAADIKANGAGCSENGTQTDALETGNSSAATM 210
            .|.|||||:.|..|::|:..|.|:::|::|::|  ..:.|.....|.:...:....|||      
  Rat   145 EVCLCLLELGRIAARYGVEPPGLIKLEKEIEQE--ETLSAPSPSPSPSSKSSGKKSTGN------ 201

  Fly   211 TTITTTTVETDLYDDSDDSETEDDGDQNPVLMYGPQPQIITNDLKSLDEMVRDLVEKCTCPSQFP 275
                       |.||:....:||                                ..|.||::|.
  Rat   202 -----------LLDDAVKRISED--------------------------------PPCKCPTKFC 223

  Fly   276 MVRVSEGKYRIGDTKVLIFVRILRS-------------------HVMVRVGGGWDTLSHYLDKHD 321
            :.|:|:|:||:|:.  ::|:|.|.|                   ||||||||||:|.:.||.|||
  Rat   224 VERLSQGRYRVGEK--ILFIRGLHSCAYVSTAKAEQTRKMLHNKHVMVRVGGGWETFAGYLLKHD 286

  Fly   322 PCRCRAQHRSSVAARLIPRQSP---NHNPSN 349
            |||.....|.......:..:||   :.||.|
  Rat   287 PCRMLQISRVDGKTSPVQSKSPTLKDMNPDN 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pigsNP_001245550.1 CH 22..159 CDD:237981 50/136 (37%)
GAS2 258..325 CDD:280367 32/85 (38%)
Gas2XP_006229335.1 CH 36..158 CDD:237981 50/137 (36%)
GAS2 201..292 CDD:295345 39/141 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343422at2759
OrthoFinder 1 1.000 - - FOG0001647
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.