DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pigs and Ppl

DIOPT Version :9

Sequence 1:NP_001245550.1 Gene:pigs / 31596 FlyBaseID:FBgn0029881 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_001100446.1 Gene:Ppl / 302934 RGDID:1305511 Length:1754 Species:Rattus norvegicus


Alignment Length:597 Identity:111/597 - (18%)
Similarity:180/597 - (30%) Gaps:229/597 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   468 RRLIDMRKKQSSLDSYSS--------GPKSLP-----------------------------GYSC 495
            |.|.|..|   :||.|..        |.:.||                             |||.
  Rat   360 RELDDQEK---ALDKYEDVVRGLQKRGQQVLPLKYRRETPLKPIPVEALCDFEGDQGLISRGYSY 421

  Fly   496 SMEEANGGS--------------------------------GVGSAAGGVSSGSAGSGVAGEQGG 528
            ::::.||.|                                .:||....|...:|||..|.:|  
  Rat   422 TLQKNNGESWELTDSTGKKLMAPAVCFIIPPTDPEALALSDSLGSQYRSVRQKAAGSKHALQQ-- 484

  Fly   529 ANKFENI-SDNGSEISDEGYRSLGVIQSGAQKRESLHSQASIEDAESNARLDQTSSD-------- 584
              :.|.: ::|..:.||            .|.|:.|            |.|||.:||        
  Rat   485 --RHEVLRTENPGDASD------------LQGRQLL------------AGLDQVASDLDRQEKAI 523

  Fly   585 --------SQISPSDEPAEKA------TTDILEEEDLNGQDREEDQEDYSVCDGPQSLPAILSGA 635
                    .|....::.||:|      |.::|:.|....|...|.:.......|..:.|.:.:..
  Rat   524 TGILRPPLEQGRAIEDSAERAKHLKNITNELLQIEPEKIQRTAECEAFVQALPGSGTTPLLKTRV 588

  Fly   636 HKLSDKFEQSGVFITDDEITVDIAKTEDQSVAN------TMGNPTPNLSKIPRSP-LAQRRRRSI 693
            ...:.|:::....:...:..||:|...:.|:..      :..|.......||.|. :...:|:.:
  Rat   589 EDTNQKYKRLVQLLEAAQEKVDVANRLENSLQRGRELLASHENRLMQDDTIPESDYMLDSKRQEL 653

  Fly   694 D---------NSTCGGAGGSLQ-------DLSSRSGLPAPAFSRKQPVYRSVRTR-NSTGATTTP 741
            :         .|..|....:||       .|:||.....|...|::.....:..| |:.....  
  Rat   654 EAMASELQAQKSLLGEVEQNLQVAKQCSSSLASRFQEHCPDLERQEAEVHKLNQRFNNLNQQV-- 716

  Fly   742 VAPPRSRQATQLPMVRDVTNTWSGRTTGAPKRRPPCTADTFVAPTNGTGPAGSFERNGKGRSSQI 806
                 .|:|..|...||..:.:             |                    .|.....|.
  Rat   717 -----ERRAQSLQSARDAYSEY-------------C--------------------RGYDHVLQF 743

  Fly   807 LYDSNGRRVRSGAPGCTSSLT--TSPVKNHASSPLAQQLLEAASSAKNDAQILEKMKSLLSRYAA 869
            |.     :..|..|..|.||:  .:.:||.      :.||:..:|.:..||.:         ||.
  Rat   744 LV-----KTPSYEPQETDSLSQMETKLKNQ------KNLLDEIASMEQGAQKV---------YAD 788

  Fly   870 GNQTKAGVGATATAANKINS-----NGKKTPVYEDFTTAWVHSNGNLERSESCSPPAKARSKRSS 929
            ..|.:..|......|.|:.|     ||:.:           |.|   :|:...||.||.:.:.::
  Rat   789 SQQYQQAVKDYELEAEKLRSLLDLENGRNS-----------HVN---KRARLQSPAAKVKEEEAA 839

  Fly   930 -AASSCESNNSN 940
             ||...|.|..|
  Rat   840 LAAKFTEVNAIN 851

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pigsNP_001245550.1 CH 22..159 CDD:237981
GAS2 258..325 CDD:280367
PplNP_001100446.1 SPEC 213..387 CDD:295325 8/29 (28%)
SMC_prok_B <467..1217 CDD:274008 93/487 (19%)
SMC_prok_B 871..1638 CDD:274008
DUF342 <899..993 CDD:302792
PLEC <1655..1683 CDD:197605
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.