DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pigs and Gas2

DIOPT Version :9

Sequence 1:NP_001245550.1 Gene:pigs / 31596 FlyBaseID:FBgn0029881 Length:977 Species:Drosophila melanogaster
Sequence 2:XP_006540681.1 Gene:Gas2 / 14453 MGIID:95657 Length:341 Species:Mus musculus


Alignment Length:351 Identity:113/351 - (32%)
Similarity:176/351 - (50%) Gaps:72/351 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EEYLEAMREDLAEWLSTLYPELSINADNFMDRLDTGVALCKHANYVRQAAVDYL-ARRQARNKS- 78
            |..|..|:||||.||:.|..: .|.|:.||::||.|..||:.|..|::...:.: |.:.|:..| 
Mouse    31 EANLLPMKEDLALWLTNLLGK-EITAETFMEKLDNGALLCQLAATVQEKFKESMDANKPAKPHSP 94

  Fly    79 -----------MTRSMTSGLAGPILAMGNVHYLPAAKSGTFFARDNVSNFITWCRKSLKIIECLL 132
                       ||::.||.|:...|.:..:....:|.||:||||||.:||::||| .|.:.|..|
Mouse    95 HFEAGFYLTSKMTQNPTSSLSSKTLPLKKIPCKASAPSGSFFARDNTANFLSWCR-DLGVDETCL 158

  Fly   133 FETDDLIMRKNEKHVILCLLEVARRGAKFGMLAPMLVQMERQIDREIAADIKANGAGCSENGTQT 197
            ||::.|::.|..:.|.|||||:.|..|::|:..|.|:::|::|::|  ..:.|.....|.:...:
Mouse   159 FESEGLVLHKQPREVCLCLLELGRIAARYGVEPPGLIKLEKEIEQE--ETLSAPSPSPSPSSKSS 221

  Fly   198 DALETGNSSAATMTTITTTTVETDLYDDSDDSETEDDGDQNPVLMYGPQPQIITNDLKSLDEMVR 262
            ....|||                 |.||:....:||                             
Mouse   222 GKKSTGN-----------------LLDDAVKRISED----------------------------- 240

  Fly   263 DLVEKCTCPSQFPMVRVSEGKYRIGDTKVLIFVRILRS-HVMVRVGGGWDTLSHYLDKHDPCRCR 326
               ..|.||::|.:.|:|:|:||:|:.  ::|:|:|.: ||||||||||:|.:.||.||||||..
Mouse   241 ---PPCKCPTKFCVERLSQGRYRVGEK--ILFIRMLHNKHVMVRVGGGWETFAGYLLKHDPCRML 300

  Fly   327 AQHRSSVAARLIPRQSP---NHNPSN 349
            ...|.......:..:||   :.||.|
Mouse   301 QISRVDGKTSPVQSKSPTLKDMNPDN 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pigsNP_001245550.1 CH 22..159 CDD:237981 56/149 (38%)
GAS2 258..325 CDD:280367 31/67 (46%)
Gas2XP_006540681.1 CH_SF 30..191 CDD:412120 60/161 (37%)
GAS2 228..301 CDD:128539 38/123 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001647
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.