DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14443 and CG5800

DIOPT Version :9

Sequence 1:NP_572330.2 Gene:CG14443 / 31595 FlyBaseID:FBgn0029880 Length:736 Species:Drosophila melanogaster
Sequence 2:NP_573230.1 Gene:CG5800 / 32742 FlyBaseID:FBgn0030855 Length:826 Species:Drosophila melanogaster


Alignment Length:468 Identity:90/468 - (19%)
Similarity:194/468 - (41%) Gaps:58/468 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 RPSNYNTWKQPMDEVYNNAANYRKRHNITLTSWNMRNL--------PEPVLSFERSGFNATILQQ 344
            |.|..|:.|:|..|:        .:..:..|...:::|        ...:..|.:...:....:.
  Fly    30 RKSGDNSQKRPRQEI--------NKSRLAATEAEIQDLKTKYAEIDATAIKKFAQFPLSKKTQKA 86

  Fly   345 LEDQGYDGPTPIQAQTWSIAKEGKNIVMISGKGTGKTLGYLLPGIMKMHNQRGLMQHKKGPIVLI 409
            |.:..:..||.:|..:...|.:||:::..:..|:||||.:|:|.:..:...:  .....|...:|
  Fly    87 LAESKFVHPTQVQRDSIGPALQGKDVLGAAITGSGKTLAFLIPVLEHLFMNK--WSRTDGVGAII 149

  Fly   410 LVDCREAAVMVQREVLYYTNPLELRTHCLLGNSQWQGHA----ECDLLVASAGRLLQMIDNKKHV 470
            :...||.|..:...:.......:.....::|....:...    :|::|:.:.|||||.:| :..:
  Fly   150 ISPTRELAYQIFETLKKVGKHHDFSAGLIIGGKNLKFERTRMDQCNILICTPGRLLQHMD-ENPL 213

  Fly   471 VELERCTYLVLDNIDRMIDVGLEGNICRLLCRLRPHAQLIVSSTSWSSNLKRMANKFLGQYTAIR 535
            ........||||..||.:|:|.:..:..::....|..|.::.|.:.::.::.:|...|.....:.
  Fly   214 FNTSTMEMLVLDEADRCLDMGFQKTLNSIIENFPPVRQTLLFSATQTNTVQDLARLNLKDPVYVG 278

  Fly   536 VG-------------EINNIGVRL--QNIRQRVEVVNGLSKVERLMKELTAIYDTSDIPGKVVIY 585
            .|             :..|..|..  :.::|...|:|...|:..|..     :..:.:..|::::
  Fly   279 YGGATPREEPSASTKKTPNTAVLAVPELLQQSYVVLNLEDKITMLWS-----FIKNHLKQKIIVF 338

  Fly   586 V---KRQKVVEELVDLIRNCVPCEGIHGGRTAQENQGIIHDFGTGAYNIIVATQMTSNCLDVPGI 647
            |   |:.|.:.|:...:|...|...::|.........|..||...::.::.:|.:.|..||.|.:
  Fly   339 VASCKQAKYLYEIFCKLRPGSPLLALYGTLHQDRRIAIYEDFLRKSHVVMFSTDVASRGLDFPAV 403

  Fly   648 RYVINYDFPDNIDKYVQRMSRTGCLSYNRNCEVISFFTMANYKLVTEVVDFLKI---CKQEIGPH 709
            .:|:..|.|:::.:|:.|..|:........|.::...:...| :::.:.:.|.|   |       
  Fly   404 NWVVQLDCPEDVSQYIHRAGRSARNKTRGECLLVLTPSEEEY-MISALKEQLNIDIRC------- 460

  Fly   710 LLQLAEEKMFGPR 722
             :|:..:|:|.||
  Fly   461 -VQIDPKKLFSPR 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14443NP_572330.2 P-loop_NTPase 332..535 CDD:304359 42/206 (20%)
DEXDc 345..544 CDD:214692 43/215 (20%)
Helicase_C 560..670 CDD:278689 24/112 (21%)
CG5800NP_573230.1 PRK01297 2..471 CDD:234938 88/465 (19%)
DEADc 74..277 CDD:238167 42/205 (20%)
HELICc 311..437 CDD:238034 27/130 (21%)
DUF4217 474..530 CDD:290667
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451444
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.