DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14443 and Ddx5

DIOPT Version :10

Sequence 1:NP_572330.2 Gene:CG14443 / 31595 FlyBaseID:FBgn0029880 Length:736 Species:Drosophila melanogaster
Sequence 2:NP_031866.2 Gene:Ddx5 / 13207 MGIID:105037 Length:615 Species:Mus musculus


Alignment Length:65 Identity:15/65 - (23%)
Similarity:26/65 - (40%) Gaps:8/65 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 QSSGIGGGFVMT------LYNASTGMCQTINARETAPAAATETMFVDNPKESVMG--YKSIATPS 201
            |:|...|.|:.:      :|..|....|.:.|:........:...|.|.|::.:.  |.|:..||
Mouse    62 QTSIAKGEFIESAEFSGNMYGTSKAAVQAVQAQNLICILDIDMQGVKNIKKTDLNPIYVSVQAPS 126

  Fly   202  201
            Mouse   127  126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14443NP_572330.2 DEAD-like_helicase_N <310..720 CDD:475120
Ddx5NP_031866.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39
DEAD-like_helicase_N 6..507 CDD:475120 15/65 (23%)
Q motif 94..122 4/27 (15%)
DEAD box 248..251
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 477..504
P68HR 498..532 CDD:429808
P68HR 551..583 CDD:429808
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.