DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment APC7 and Cdc27

DIOPT Version :9

Sequence 1:NP_572329.3 Gene:APC7 / 31594 FlyBaseID:FBgn0029879 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_001261503.1 Gene:Cdc27 / 38798 FlyBaseID:FBgn0012058 Length:900 Species:Drosophila melanogaster


Alignment Length:290 Identity:63/290 - (21%)
Similarity:109/290 - (37%) Gaps:72/290 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 AIGLMAVLCGQEGGCEQDSADMDYLFAKVSSEVKYTASHWFAHAQLLYDEGKFERGLNFVEKCLD 349
            |.||||:|.|                              .|.|..|....:.:..:..:|..: 
  Fly   536 ADGLMALLRG------------------------------LAEAYQLLSNFQCKAAIKQLETTI- 569

  Fly   350 SEPRNH------EALILRGRLLIALERHTQAVCAFRTAQMVAPYR---FEIY-RGLFHSYLAQKR 404
              |::|      ::||  |.....:..:..||..|.|.....|.|   .||| ..|:|    .:|
  Fly   570 --PKHHLNSSWVQSLI--GLARYEMREYEAAVAIFETIHKTEPCRLDYMEIYSSSLWH----LQR 626

  Fly   405 FKEANALCNWTIRLFQNSPRSFTMFGRTLFLFPDPRMRRTARKFAEKSLKINHIYTPAVNLIA-D 468
            ..|.:||....|...:.||.::.:.|....|   .:...||.||.:::::::..:..:..|:. :
  Fly   627 EVELSALAQDLINQDKTSPVTWCVSGNCFSL---QKEHETAIKFFKRAVQVDPDFVYSYTLLGHE 688

  Fly   469 ICQVEGPTKAIIKLLEKHVIIFPK-VNLLNHLGDIMRKQKEPVKAMEYYYKALRQDP-------- 524
            :...|...|| :......|:..|: .|....:|.|..||::...|..:|.|||:.:|        
  Fly   689 LVLTEEFDKA-MDYFRAAVVRDPRHYNAWYGIGTIYSKQEKYELAEIHYVKALKINPQNSVILVH 752

  Fly   525 ---------KSKRTLRGLRLLAKSDDESPV 545
                     |...:|:.|...|..|.::|:
  Fly   753 IGAMQFYMKKKDLSLQTLNTAATLDPKNPL 782

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
APC7NP_572329.3 TPR repeat 251..277 CDD:276809
TPR_11 321..386 CDD:290150 13/70 (19%)
TPR repeat 321..349 CDD:276809 4/27 (15%)
TPR repeat 354..384 CDD:276809 8/35 (23%)
TPR_11 356..418 CDD:290150 19/65 (29%)
TPR repeat 459..489 CDD:276809 5/30 (17%)
TPR repeat 493..521 CDD:276809 9/27 (33%)
Cdc27NP_001261503.1 ANAPC3 16..94 CDD:289650
TPR_11 67..145 CDD:290150
TPR repeat 68..104 CDD:276809
TPR repeat 109..143 CDD:276809
TPR_12 539..601 CDD:290160 16/96 (17%)
TPR repeat 582..605 CDD:276809 7/24 (29%)
TPR 590..850 CDD:223533 47/201 (23%)
TPR_1 645..678 CDD:278916 7/35 (20%)
TPR repeat 678..708 CDD:276809 5/30 (17%)
TPR_1 713..746 CDD:278916 11/32 (34%)
TPR repeat 713..741 CDD:276809 9/27 (33%)
TPR repeat 747..773 CDD:276809 3/25 (12%)
TPR repeat 781..809 CDD:276809 1/2 (50%)
TPR repeat 815..838 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449292
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12558
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.