DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment APC7 and Cdc27

DIOPT Version :10

Sequence 1:NP_572329.3 Gene:APC7 / 31594 FlyBaseID:FBgn0029879 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_648093.2 Gene:Cdc27 / 38798 FlyBaseID:FBgn0012058 Length:900 Species:Drosophila melanogaster


Alignment Length:290 Identity:63/290 - (21%)
Similarity:109/290 - (37%) Gaps:72/290 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 AIGLMAVLCGQEGGCEQDSADMDYLFAKVSSEVKYTASHWFAHAQLLYDEGKFERGLNFVEKCLD 349
            |.||||:|.|                              .|.|..|....:.:..:..:|..: 
  Fly   536 ADGLMALLRG------------------------------LAEAYQLLSNFQCKAAIKQLETTI- 569

  Fly   350 SEPRNH------EALILRGRLLIALERHTQAVCAFRTAQMVAPYR---FEIY-RGLFHSYLAQKR 404
              |::|      ::||  |.....:..:..||..|.|.....|.|   .||| ..|:|    .:|
  Fly   570 --PKHHLNSSWVQSLI--GLARYEMREYEAAVAIFETIHKTEPCRLDYMEIYSSSLWH----LQR 626

  Fly   405 FKEANALCNWTIRLFQNSPRSFTMFGRTLFLFPDPRMRRTARKFAEKSLKINHIYTPAVNLIA-D 468
            ..|.:||....|...:.||.::.:.|....|   .:...||.||.:::::::..:..:..|:. :
  Fly   627 EVELSALAQDLINQDKTSPVTWCVSGNCFSL---QKEHETAIKFFKRAVQVDPDFVYSYTLLGHE 688

  Fly   469 ICQVEGPTKAIIKLLEKHVIIFPK-VNLLNHLGDIMRKQKEPVKAMEYYYKALRQDP-------- 524
            :...|...|| :......|:..|: .|....:|.|..||::...|..:|.|||:.:|        
  Fly   689 LVLTEEFDKA-MDYFRAAVVRDPRHYNAWYGIGTIYSKQEKYELAEIHYVKALKINPQNSVILVH 752

  Fly   525 ---------KSKRTLRGLRLLAKSDDESPV 545
                     |...:|:.|...|..|.::|:
  Fly   753 IGAMQFYMKKKDLSLQTLNTAATLDPKNPL 782

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
APC7NP_572329.3 CpoB 34..135 CDD:441335
LapB 108..411 CDD:442196 29/135 (21%)
TPR repeat 251..277 CDD:276809
LapB 254..523 CDD:442196 56/249 (22%)
TPR repeat 321..349 CDD:276809 4/27 (15%)
TPR repeat 354..384 CDD:276809 8/35 (23%)
TPR repeat 459..489 CDD:276809 5/30 (17%)
TPR repeat 493..521 CDD:276809 9/27 (33%)
Cdc27NP_648093.2 ANAPC3 16..94 CDD:463743
BepA 38..168 CDD:443813
TPR repeat 68..104 CDD:276809
TPR repeat 109..143 CDD:276809
Spy 540..>753 CDD:443119 54/255 (21%)
TPR repeat 582..605 CDD:276809 7/24 (29%)
TPR 652..>809 CDD:440225 29/135 (21%)
TPR repeat 678..708 CDD:276809 5/30 (17%)
TPR repeat 713..741 CDD:276809 9/27 (33%)
TPR repeat 747..773 CDD:276809 3/25 (12%)
TPR 776..>850 CDD:440225 2/7 (29%)
TPR repeat 781..809 CDD:276809 1/2 (50%)
TPR repeat 815..838 CDD:276809
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.