DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment APC7 and CG31687

DIOPT Version :9

Sequence 1:NP_572329.3 Gene:APC7 / 31594 FlyBaseID:FBgn0029879 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_001163022.1 Gene:CG31687 / 318886 FlyBaseID:FBgn0051687 Length:351 Species:Drosophila melanogaster


Alignment Length:299 Identity:68/299 - (22%)
Similarity:105/299 - (35%) Gaps:96/299 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 YLLNANYKERNYRAALRHFDEIIHKRRLMMRHKNAVLVAIESSYPEFGDAEQRRRAAECYRQIGN 124
            |.|..:|.:      :|.:|...|..|           ..|||.|.|........|.|..|....
  Fly    76 YFLAKSYYD------VREYDRAAHAVR-----------NCESSVPRFLHFYSSYMAREKRRLDST 123

  Fly   125 TDMAIETLLQVPPTLRSPRINLMLARLQHHGSR--------HGTTKK-------SEAVLAYKEVI 174
            ||.|   .|..|..:|.....|...|:::..||        :|...|       :|.:|.  :.|
  Fly   124 TDQA---NLHEPNQMRDLADLLATLRMEYGKSRLDGYGIYLYGVVLKALNLNQAAEQMLV--QAI 183

  Fly   175 RECPMALQVIEALLELGVNGNEINSLVMH-----AATVPDHFDWLSKWIKALAQMFNFKHSDASQ 234
            |..||   :..|.|||       :.|:|.     :..:..|  |:             :|...:.
  Fly   184 RLVPM---LWSAYLEL-------SPLIMEKKKLLSLQLGGH--WM-------------RHFFMAH 223

  Fly   235 TFLMLHDNTT-LRCNEHL-------------MMALGKCLYYN-GDYFQAEDIFSSTL-CANP--- 280
            |:|.|:.|.. |:..|.|             .|||   :|:| .|..:|.:::.:.| .|:|   
  Fly   224 TYLELYLNDDGLKIYEDLQASGFSKSIYLIAQMAL---VYHNKRDVDKAIELYQALLESASPYRL 285

  Fly   281 DNVEAIGLMAVLCGQEGGCEQDSADMDYLFAKVSSEVKY 319
            |||:....:..:       ::...:|..|..|..|..||
  Fly   286 DNVDTYSNLLFV-------KEMKTEMAQLAHKAVSINKY 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
APC7NP_572329.3 TPR repeat 251..277 CDD:276809 9/40 (23%)
TPR_11 321..386 CDD:290150
TPR repeat 321..349 CDD:276809
TPR repeat 354..384 CDD:276809
TPR_11 356..418 CDD:290150
TPR repeat 459..489 CDD:276809
TPR repeat 493..521 CDD:276809
CG31687NP_001163022.1 ANAPC8 11..119 CDD:281973 14/59 (24%)
TPR repeat 255..278 CDD:276809 7/25 (28%)
TPR repeat 287..314 CDD:276809 5/33 (15%)
TPR repeat 319..347 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449295
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.