DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pat1 and KLC4

DIOPT Version :9

Sequence 1:NP_001259286.1 Gene:Pat1 / 31593 FlyBaseID:FBgn0029878 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_958931.1 Gene:KLC4 / 89953 HGNCID:21624 Length:637 Species:Homo sapiens


Alignment Length:536 Identity:122/536 - (22%)
Similarity:192/536 - (35%) Gaps:144/536 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 KMLAKRLSENYVSRYEVVAGH--EEEELESSMDTVED-----RSTEFSSLYTYDSESTNADSISD 163
            |:...|:|...:.:.:..|||  .:||:..|...|..     ||...:.|   .|.|...:.:..
Human    13 KVPQARMSGLVLGQRDEPAGHRLSQEEILGSTRLVSQGLEALRSEHQAVL---QSLSQTIECLQQ 74

  Fly   164 FNDEFSADIGSIVGLPHRRATQ--EELDAINDSGLEELSAVELQVIDLGLRLGSFLSEAGWMQES 226
            ...|        .||.|.:|.|  ..::.|      ||...|.||:   |.|.|.||.....::.
Human    75 GGHE--------EGLVHEKARQLRRSMENI------ELGLSEAQVM---LALASHLSTVESEKQK 122

  Fly   227 ITVLACLNVRLKDLPTHKHWLQFRL-DCLQRLLYAESAHCNFKEAEKTYAELMG-LNKW------ 283
                  |..:::.|.....||:..| ...|||..:|.|....:| ||.:.|.:| |.::      
Human   123 ------LRAQVRRLCQENQWLRDELAGTQQRLQRSEQAVAQLEE-EKKHLEFLGQLRQYDEDGHT 180

  Fly   284 ------------LNKSVPNQLVAITYSQISAMYFARNEYKNSHLWSGLAMRFLK--GYANP---R 331
                        |:...||:               ..|..::.|..|......:  ||..|   |
Human   181 SEEKEGDATKDSLDDLFPNE---------------EEEDPSNGLSRGQGATAAQQGGYEIPARLR 230

  Fly   332 TIIDVLRQAAKACVVKRDFARANLLICQAVRRAREYFGPTHQKYGDALLDYGFFLLNVDS-VFQS 395
            |:.:::.|.|    .:..:..|..|..||:.......|..|.....        :||:.: |::.
Human   231 TLHNLVIQYA----AQGRYEVAVPLCKQALEDLERTSGRGHPDVAT--------MLNILALVYRD 283

  Fly   396 VNIYKEALAVRRGIFGNMNFHVAIAHEDLSYAYYVHEYSTGDFSCAQDHVDKAVNIMQHLVPSNH 460
            .|.||||                 ||. |:.|..:.|.:.|     .||...|..:       |:
Human   284 QNKYKEA-----------------AHL-LNDALSIRESTLG-----PDHPAVAATL-------NN 318

  Fly   461 LMLASAKRVKALLLEEIALDKMADGIDEEDLLLQSEELHNFALLLSLQVFGEVNVQTAKHYGNLG 525
            |.:...||.|                     ..::|.|...||.:..:|.|..:...||...||.
Human   319 LAVLYGKRGK---------------------YKEAEPLCQRALEIREKVLGTNHPDVAKQLNNLA 362

  Fly   526 RLYQTMNRFEEAERMHKKAIKIKSELLGHFDYEVGLSIGHLASLYNYQMKKYRDAEQLYMRSIDI 590
            .|.|...::|..||.:::|:.|....||..:..|..:..:|||.| .:..||.:||.||.   :|
Human   363 LLCQNQGKYEAVERYYQRALAIYEGQLGPDNPNVARTKNNLASCY-LKQGKYAEAETLYK---EI 423

  Fly   591 SLRLFGNSYSGLEYDY 606
            ..|.....:..::.|:
Human   424 LTRAHVQEFGSVDDDH 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pat1NP_001259286.1 DnaQ_like_exo <53..110 CDD:299142 1/3 (33%)
TPR_12 478..547 CDD:290160 16/68 (24%)
TPR_12 516..590 CDD:290160 24/73 (33%)
TPR_10 517..553 CDD:290111 11/35 (31%)
TPR repeat 518..546 CDD:276809 10/27 (37%)
TPR repeat 559..590 CDD:276809 11/30 (37%)
TPR repeat 603..628 CDD:276809 1/4 (25%)
KLC4NP_958931.1 SMC_N 51..>166 CDD:330553 35/141 (25%)
TPR_12 228..303 CDD:315987 22/104 (21%)
TPR repeat 230..257 CDD:276809 8/30 (27%)
TPR_12 269..345 CDD:315987 26/134 (19%)
TPR repeat 271..299 CDD:276809 12/53 (23%)
TPR_12 312..386 CDD:315987 23/101 (23%)
TPR repeat 313..341 CDD:276809 9/55 (16%)
TPR_12 353..427 CDD:315987 25/77 (32%)
TPR repeat 354..384 CDD:276809 10/29 (34%)
TPR_12 396..514 CDD:315987 14/48 (29%)
TPR repeat 397..424 CDD:276809 10/30 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1840
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.