DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pat1 and KLCR1

DIOPT Version :10

Sequence 1:NP_572328.1 Gene:Pat1 / 31593 FlyBaseID:FBgn0029878 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_192822.1 Gene:KLCR1 / 826680 AraportID:AT4G10840 Length:609 Species:Arabidopsis thaliana


Alignment Length:263 Identity:62/263 - (23%)
Similarity:116/263 - (44%) Gaps:37/263 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   372 HQKYGDALLDYGFFLLNVDSVFQSVNIYKEALAVRRGIFGNMNFHVAIAHEDLSYAYYVHEYSTG 436
            |.:.||.|...|       .:.:|:..|:|.|.::....|:.:..|......|:.||    ....
plant   186 HMQLGDTLSMLG-------QIDRSIACYEEGLKIQIQTLGDTDPRVGETCRYLAEAY----VQAM 239

  Fly   437 DFSCAQDHVDKAVNIMQ-HLVPSNHLMLASAKRVKALLLEEIALDKMADGIDEEDLLLQSEELHN 500
            .|:.|::...|.:.|.: |..|:: |..|:.:|:.|::.|       |.| |.|: .|:...|.:
plant   240 QFNKAEELCKKTLEIHRAHSEPAS-LEEAADRRLMAIICE-------AKG-DYEN-ALEHLVLAS 294

  Fly   501 FALLLSLQVFGEVNVQTAKHYGNLGRLYQTMNRFEEAERMHKKAIKIKSELLGHFDYEVGLSIGH 565
            .|::.|.|.....::..     ::|.:|.::.||:||...::||:.:.....|.....|......
plant   295 MAMIASGQESEVASIDV-----SIGNIYMSLCRFDEAVFSYQKALTVFKASKGETHPTVASVFVR 354

  Fly   566 LASLYNYQMKKYRDAEQLYMRSIDISLRLFGNSYSGLEYDYL--GLCH---VYETLHNFEKYLKY 625
            ||.|| ::..|.|:::. |..:   :||::.....|...:.:  ||..   :||::...|:.||.
plant   355 LAELY-HRTGKLRESKS-YCEN---ALRIYNKPVPGTTVEEIAGGLTEISAIYESVDEPEEALKL 414

  Fly   626 AHK 628
            ..|
plant   415 LQK 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pat1NP_572328.1 Spy 471..>628 CDD:443119 38/161 (24%)
TPR_12 516..590 CDD:315987 17/73 (23%)
TPR repeat 518..546 CDD:276809 8/27 (30%)
TPR repeat 559..590 CDD:276809 8/30 (27%)
TPR repeat 603..628 CDD:276809 7/29 (24%)
KLCR1NP_192822.1 TPR_12 88..169 CDD:315987
LapB 139..462 CDD:442196 62/263 (24%)
TPR repeat 140..168 CDD:276809
TPR repeat 178..212 CDD:276809 9/32 (28%)
TPR repeat 225..253 CDD:276809 6/31 (19%)
TPR repeat 259..290 CDD:276809 11/40 (28%)
TPR 343..583 CDD:440225 19/80 (24%)
TPR repeat 348..378 CDD:276809 9/34 (26%)
TPR repeat 392..420 CDD:276809 8/26 (31%)
TPR repeat 438..468 CDD:276809
TPR repeat 473..506 CDD:276809
TPR repeat 516..544 CDD:276809
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.