DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pat1 and klc4

DIOPT Version :9

Sequence 1:NP_001259286.1 Gene:Pat1 / 31593 FlyBaseID:FBgn0029878 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_001017813.1 Gene:klc4 / 550511 ZFINID:ZDB-GENE-050417-350 Length:185 Species:Danio rerio


Alignment Length:171 Identity:45/171 - (26%)
Similarity:73/171 - (42%) Gaps:42/171 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 MNTKI-PALDRISRLAE----LPRNLLIDVYE-MMSQQESLKDTLLEELAQL--EVFARLVRYPF 89
            |:|.: |..:|:.:|.:    ....|:|...| :.|:..|:..:|||.:..|  :..|.||.   
Zfish     1 MSTMVYPREERLEKLTQDEIISSTKLVIQGLEALKSEHNSILQSLLETIQCLKKDEEASLVH--- 62

  Fly    90 ARSQLLR-----IMASLMASQKMLA-------------------KRL-SENYVSRYEVV-AGHEE 128
            .:|.|||     |...|..:|.|:|                   :|| .||...|.|:. ..|:.
Zfish    63 EKSSLLRKSVEMIELGLGEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQHKV 127

  Fly   129 EELESSMDTVED--RSTEF-SSLYTYDSESTNADSISDFND 166
            ::.|.|:..:|:  :..|| :.|..||..:|  ..:|..||
Zfish   128 QKSEQSVAQLEEEKKHLEFMNQLKKYDDGAT--PEVSPHND 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pat1NP_001259286.1 DnaQ_like_exo <53..110 CDD:299142 21/83 (25%)
TPR_12 478..547 CDD:290160
TPR_12 516..590 CDD:290160
TPR_10 517..553 CDD:290111
TPR repeat 518..546 CDD:276809
TPR repeat 559..590 CDD:276809
TPR repeat 603..628 CDD:276809
klc4NP_001017813.1 SMC_prok_B 31..>145 CDD:274008 29/116 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.