DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pat1 and Ttc19

DIOPT Version :9

Sequence 1:NP_001259286.1 Gene:Pat1 / 31593 FlyBaseID:FBgn0029878 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_609934.3 Gene:Ttc19 / 35172 FlyBaseID:FBgn0032744 Length:369 Species:Drosophila melanogaster


Alignment Length:228 Identity:42/228 - (18%)
Similarity:96/228 - (42%) Gaps:44/228 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   441 AQDHVDKAVNIMQHLVPSNHLMLASAKRVKAL-----LLEEIA--LDKMADGIDEEDLLLQSEEL 498
            |:.|.:::..|:.......|:........|:.     .|:::|  |:||.   |::|:       
  Fly   169 AEGHTEESPKILHISSKIAHMSQLQGDLEKSFQGFTWTLQQLAKLLEKMP---DDKDI------- 223

  Fly   499 HNFALLLSLQVFGEVNVQTAKHYGNLGRLYQTMNRFEEAERMHKKAIKIKSELLGHFDYEVGLSI 563
                    |:::|     ..|::  .|:|.....::.||:.:.|:|......:.|..: :..::|
  Fly   224 --------LELYG-----LTKNW--FGQLLMKQGKYLEAKNLFKEAFDTLINVYGAVN-DASVTI 272

  Fly   564 GHLASLYNYQMKKYRDAEQLYMRSIDISLRLFGNSYSGLEYDYLGLCHVYETL-HNFEKYLKYAH 627
            .:..|:....::||.:|.:..:.:::::..|...:..|:....|||.::.|.| ...|...:.|.
  Fly   273 LNNISVAYVNLEKYAEARETLLEAMELTKELKDATQEGILQANLGLVYLREGLMSQAENACRLAW 337

  Fly   628 KLENWQMLRGQNLTQNKSSYPAIEVDYSIEEVK 660
            ||..          |:::.....:.:|.:.|:|
  Fly   338 KLGK----------QHQNPDAVEQAEYCLNEIK 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pat1NP_001259286.1 DnaQ_like_exo <53..110 CDD:299142
TPR_12 478..547 CDD:290160 15/70 (21%)
TPR_12 516..590 CDD:290160 13/73 (18%)
TPR_10 517..553 CDD:290111 7/35 (20%)
TPR repeat 518..546 CDD:276809 7/27 (26%)
TPR repeat 559..590 CDD:276809 5/30 (17%)
TPR repeat 603..628 CDD:276809 7/25 (28%)
Ttc19NP_609934.3 TPR_12 235..302 CDD:290160 12/67 (18%)
TPR repeat 269..299 CDD:276809 5/29 (17%)
TPR_11 272..339 CDD:290150 14/66 (21%)
TPR repeat 304..338 CDD:276809 8/33 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1840
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.