DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17717 and SSM4

DIOPT Version :9

Sequence 1:NP_572327.1 Gene:CG17717 / 31592 FlyBaseID:FBgn0029877 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_012234.3 Gene:SSM4 / 854781 SGDID:S000001292 Length:1319 Species:Saccharomyces cerevisiae


Alignment Length:238 Identity:55/238 - (23%)
Similarity:95/238 - (39%) Gaps:74/238 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 SHLQESLHS-ANE------------SGNSCRICRWNRNDMEIIKCPCNCKGSVGYIHLKCLKRWI 126
            |.|::.||. |||            ||.:|||||....:...:..||.|:||:.|:|..||..|:
Yeast    10 SRLRDELHKVANEETDTATFNDDAPSGATCRICRGEATEDNPLFHPCKCRGSIKYMHESCLLEWV 74

  Fly   127 MHRR--------DNRCEICN------AVF--NIAEE---RASLKQMIRTFCCGRCCGLIVKHLLF 172
            ..:.        |.:|:||:      .::  |:.|:   ...|.:.|.||       .....|..
Yeast    75 ASKNIDISKPGADVKCDICHYPIQFKTIYAENMPEKIPFSLLLSKSILTF-------FEKARLAL 132

  Fly   173 SASLMPLAHIILQQVLQCM-----DNMNQGST--------------DQLTVQEVFVASCALLTSS 218
            :..|..:.:||...::..|     ..|..||:              ||....|        ||:.
Yeast   133 TIGLAAVLYIIGVPLVWNMFGKLYTMMLDGSSPYPGDFLKSLIYGYDQSATPE--------LTTR 189

  Fly   219 ALFFHFFE---FVTTRFMLIRNILSHWWMFGSTSDFELVEIED 258
            |:|:...:   |.:.:|::|  ::.|..::   ..::::..||
Yeast   190 AIFYQLLQNHSFTSLQFIMI--VILHIALY---FQYDMIVRED 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17717NP_572327.1 RINGv 91..138 CDD:128983 18/54 (33%)
SSM4NP_012234.3 SSM4 22..1319 CDD:227510 49/226 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R328
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.