DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17717 and AT1G50440

DIOPT Version :9

Sequence 1:NP_572327.1 Gene:CG17717 / 31592 FlyBaseID:FBgn0029877 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001117462.1 Gene:AT1G50440 / 841466 AraportID:AT1G50440 Length:250 Species:Arabidopsis thaliana


Alignment Length:155 Identity:39/155 - (25%)
Similarity:58/155 - (37%) Gaps:44/155 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 EAICSSQIVASAHGTPTASTAAL-EISSARQRMLRSHLQESLHSANESGNSCRICRWNRNDM--E 102
            |:..|::|||:..|........: ||:....       .|:....:.....||||.    |:  |
plant    20 ESTSSNEIVAAERGDRVVEEGQVSEIAETDD-------DETTLLVSGDQPQCRICL----DVGGE 73

  Fly   103 IIKCPCNCKGSVGYIHLKCLKRWIMHRRD---NRCEICNAVF----NIAEERASLK--------- 151
            .:..||||||:..::|..||..|...:..   :.|..|.|.|    |:..:|..|:         
plant    74 DLIAPCNCKGTQKHVHRSCLDNWRSTKEGFAFSHCTECRAFFKLRANVPADRWWLRLRFQLLVAR 138

  Fly   152 ---------QMIRTFCCGRCCGLIV 167
                     |||..|     .||:|
plant   139 DHAFIFISVQMIVAF-----LGLLV 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17717NP_572327.1 RINGv 91..138 CDD:128983 17/51 (33%)
AT1G50440NP_001117462.1 RING_CH-C4HC3_MARCH 64..112 CDD:319409 17/51 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000792
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.