DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17717 and AT2G45530

DIOPT Version :10

Sequence 1:NP_572327.1 Gene:CG17717 / 31592 FlyBaseID:FBgn0029877 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_566045.1 Gene:AT2G45530 / 819161 AraportID:AT2G45530 Length:240 Species:Arabidopsis thaliana


Alignment Length:77 Identity:22/77 - (28%)
Similarity:41/77 - (53%) Gaps:4/77 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 SARQRMLRSHLQESLHSANESGNS---CRICRWNRNDMEIIKCPCNCKGSVGYIHLKCLKRWIMH 128
            |:|:.::.....|...|.:.:|:|   ||:|..::.:: :|:..|.|:|.:...|..|:..|...
plant    47 SSREELVGQIPPEKEVSLSRNGSSHEQCRVCLQDKEEV-LIELGCQCRGGLAKAHRSCIDAWFRT 110

  Fly   129 RRDNRCEICNAV 140
            :..|:||||..|
plant   111 KGSNQCEICQVV 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17717NP_572327.1 RINGv 91..138 CDD:128983 14/46 (30%)
AT2G45530NP_566045.1 RINGv 73..120 CDD:128983 14/47 (30%)

Return to query results.
Submit another query.