DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17717 and zgc:158785

DIOPT Version :9

Sequence 1:NP_572327.1 Gene:CG17717 / 31592 FlyBaseID:FBgn0029877 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001074165.1 Gene:zgc:158785 / 791214 ZFINID:ZDB-GENE-070112-1712 Length:231 Species:Danio rerio


Alignment Length:209 Identity:49/209 - (23%)
Similarity:86/209 - (41%) Gaps:39/209 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 SAHGTPTASTAALEIS----SARQRMLRSHLQESLHSANESGNSCRICRWNRNDMEIIKCPCNCK 111
            ||:|..:|..:.|:::    |:...:........:.|.......||||..:....:::. ||.|.
Zfish     6 SANGLSSAPDSVLQVNPDTESSTDPLPDPVSPNGIFSVIAEEPFCRICHEDSAAGDLLS-PCECA 69

  Fly   112 GSVGYIHLKCLKRWIMHRRDNRCEICNAVFNIAEER-----------ASLKQMIRTFCCGRCCGL 165
            ||:..:|..||::|:.....:.||:|:  |..|.||           .|::|..||.|....|.|
Zfish    70 GSLAMVHRVCLEQWLTASGTSSCELCH--FQYALERLPKPFTEWLSAPSMQQQRRTLCGDVICFL 132

  Fly   166 IVKHLLFSASLMPLAHIILQQVLQCMDNMNQGSTDQLTVQEVFVASCALLTSSALF--FHFFEFV 228
            .:         .|||.:   ....|:    ||:.|......:......:||.: ||  :.|:..|
Zfish   133 FI---------TPLASL---SGWLCV----QGAMDLYYSNGMEAVGLIILTLT-LFTIYLFWTVV 180

  Fly   229 TTRFMLIRNILSHW 242
            :.|:.:  ::...|
Zfish   181 SLRYHI--HLFRTW 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17717NP_572327.1 RINGv 91..138 CDD:128983 15/46 (33%)
zgc:158785NP_001074165.1 RINGv 49..96 CDD:128983 15/47 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000792
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46065
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.