DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17717 and Marchf1

DIOPT Version :9

Sequence 1:NP_572327.1 Gene:CG17717 / 31592 FlyBaseID:FBgn0029877 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_006509817.1 Gene:Marchf1 / 72925 MGIID:1920175 Length:453 Species:Mus musculus


Alignment Length:168 Identity:31/168 - (18%)
Similarity:73/168 - (43%) Gaps:25/168 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 AEAICSSQIVASAHGTPTASTAALEISSARQRMLRSHLQESLHSANESGNSCRICRWNRNDMEII 104
            :|...:::|:|:...........|:::::.|:...::     ...:::...||||....::...:
Mouse   198 SETDFNTEILAAVERDECGEDTGLQLNTSTQKPPAAY-----DDGSDNFEVCRICHCEGDEESPL 257

  Fly   105 KCPCNCKGSVGYIHLKCLKRWIMHRRDNRCEICNAVFNIAEERASLK-----QMI-----RTFCC 159
            ..||.|.|::.::|..||.:||.......||:|...|.:..:...|:     ||.     :.||.
Mouse   258 ITPCRCTGTLRFVHQSCLHQWIKSSDTRCCELCKYDFIMETKLKPLRKWEKLQMTTSERRKIFCS 322

  Fly   160 GRCCGLIVKHLLFSASLMPLAHIIL----QQVLQCMDN 193
                  :..|::....::...::::    :::.|..||
Mouse   323 ------VTFHVIAVTCVVWSLYVLIDRTAEEIKQGNDN 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17717NP_572327.1 RINGv 91..138 CDD:128983 15/46 (33%)
Marchf1XP_006509817.1 RING_CH-C4HC3_MARCH1_like 243..294 CDD:319612 16/50 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R328
SonicParanoid 1 1.000 - - X270
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.