DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17717 and Marchf7

DIOPT Version :9

Sequence 1:NP_572327.1 Gene:CG17717 / 31592 FlyBaseID:FBgn0029877 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_036018314.1 Gene:Marchf7 / 57438 MGIID:1931053 Length:730 Species:Mus musculus


Alignment Length:265 Identity:57/265 - (21%)
Similarity:100/265 - (37%) Gaps:52/265 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SAGNAT--MPLG-----------------AQPP---QSAAAEAICSSQIVASAHGTPTASTAALE 64
            :||.:|  :|.|                 |.||   .:.|...:.:..|:.|...:........:
Mouse   459 AAGGSTPELPQGGRNPGLTGILPGSLFRFAVPPALGSNLADNVMITVDIIPSGWNSTDGKNDKAK 523

  Fly    65 ISSARQRMLRSHLQESL----HSANESGNSCRICRW-NRNDMEIIKCPCNCKGSVGYIHLKCLKR 124
            .:.:|.......::|||    ....|.|:.||||:. ..:...::..||.|.||:.|:|.:|:|:
Mouse   524 SAPSRDPEKLQKIKESLLLEDSDDEEEGDLCRICQMAAASSSNLLIEPCKCTGSLQYVHQECMKK 588

  Fly   125 WIMHRRDN--------RCEICNAVFNIAEERASLKQMIRTFCCGRCCGLIVKHLLFSASLMPLAH 181
            |:..:.::        .||:|.....:..|...:.::.|.....:.....:...|:   |:.|.|
Mouse   589 WLQAKINSGSSLEAVTTCELCKEKLQLNLEDFDIHELHRAHANEQAEYEFISSGLY---LVVLLH 650

  Fly   182 IILQQVLQCMDNMNQGSTDQLTVQEVFVASCALLTSSALFFHFFEFVTTRFML--IR----NILS 240
            :..|.....|.|..:.||.        |....|..:........|.|.::.:|  :|    |.||
Mouse   651 LCEQSFSDMMGNTIEPSTR--------VRFINLARTLQAHMEDLETVISQILLRCVRALALNSLS 707

  Fly   241 HWWMF 245
            .|.||
Mouse   708 LWCMF 712

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17717NP_572327.1 RINGv 91..138 CDD:128983 16/55 (29%)
Marchf7XP_036018314.1 RING_Ubox 554..612 CDD:418438 17/57 (30%)
RING-CH finger (C4HC3-type) 554..609 CDD:319361 16/54 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.