DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17717 and march2

DIOPT Version :9

Sequence 1:NP_572327.1 Gene:CG17717 / 31592 FlyBaseID:FBgn0029877 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001038255.2 Gene:march2 / 555611 ZFINID:ZDB-GENE-050208-777 Length:249 Species:Danio rerio


Alignment Length:233 Identity:50/233 - (21%)
Similarity:85/233 - (36%) Gaps:48/233 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ESAGNATMPLGAQPPQSAAAEAICSSQIVASAHGTPTASTAALEISSARQRMLRSHLQESLHSAN 85
            :..|||.:....:...:..|:.:  :|:.|......:....||...|.|.               
Zfish    15 DCTGNAALSKTVEEADNRRAQYV--TQVTAKDGRLLSTVIKALGTQSDRP--------------- 62

  Fly    86 ESGNSCRICRWNRN--DMEIIKCPCNCKGSVGYIHLKCLKRWIMHRRDNRCEICNAVFNIAEERA 148
                :||||...::  :.|.:..||:|.|::|.:|..||::|:.....:.||:|:..|.|.....
Zfish    63 ----TCRICHEGQDVCNSEGLLSPCDCTGTLGTVHKSCLEKWLSSSNTSYCELCHTEFTIERRPR 123

  Fly   149 SLKQMI---------RTFCCGRCCGLIVKHLLFSASLMPLAHIILQQVLQCMDNMNQGSTDQLTV 204
            .|.:.:         ||..|...|.|.:         .|||.|   ....|:    :|:.|.|..
Zfish   124 PLTEWLRDPGPRNEKRTLFCDMVCFLFI---------TPLAAI---SGWLCL----RGAQDHLHF 172

  Fly   205 QEVFVASCALLTSSALFFHFFEFVTTRFMLIRNILSHW 242
            .....|...:..:.|||..:..:....|.....:.|.|
Zfish   173 NSRLEAVGLIALTIALFTIYVLWTLVSFRYHCQLYSEW 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17717NP_572327.1 RINGv 91..138 CDD:128983 16/48 (33%)
march2NP_001038255.2 RINGv 64..113 CDD:128983 16/48 (33%)
Vpu 176..>220 CDD:109608 7/35 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000792
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46065
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.