DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17717 and marchf2

DIOPT Version :9

Sequence 1:NP_572327.1 Gene:CG17717 / 31592 FlyBaseID:FBgn0029877 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_017949123.1 Gene:marchf2 / 549760 XenbaseID:XB-GENE-945914 Length:258 Species:Xenopus tropicalis


Alignment Length:185 Identity:43/185 - (23%)
Similarity:76/185 - (41%) Gaps:27/185 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 SARQRMLRSHLQESLHSANESGNSCRICRWNRNDMEIIKCPCNCKGSVGYIHLKCLKRWIMHRRD 131
            :|:...|.|.:.::|.:.:: |..||||....|...::. ||:|.|::|.:|..||::|:.....
 Frog    53 TAKDGQLLSTVIKALGTQSD-GPICRICHEGGNGERLLS-PCDCTGTLGTVHKTCLEKWLSSSNT 115

  Fly   132 NRCEICNAVFNIAEERASLKQMI---------RTFCCGRCCGLIVKHLLFSASLMPLAHIILQQV 187
            :.||:|:..|.:......:.:.:         ||..|...|.|.:         .|||.|   ..
 Frog   116 SYCELCHTEFAVERRPRPVTEWLKDPGPRNEKRTLFCDMVCFLFI---------TPLAAI---SG 168

  Fly   188 LQCMDNMNQGSTDQLTVQEVFVASCALLTSSALFFHFFEFVTTRFMLIRNILSHW 242
            ..|:    :|:.|.|.......|...:..:.|||..:..:....|.....:.|.|
 Frog   169 WLCL----RGAQDHLQFNSRLEAVGLIALTIALFTIYVLWTLVSFRYHCQLYSEW 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17717NP_572327.1 RINGv 91..138 CDD:128983 16/46 (35%)
marchf2XP_017949123.1 RING_CH-C4HC3_MARCH2 74..125 CDD:319722 17/51 (33%)
RING-CH finger (C4HC3-type) 76..121 CDD:319722 16/45 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000792
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46065
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.