DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17717 and MARCHF2

DIOPT Version :9

Sequence 1:NP_572327.1 Gene:CG17717 / 31592 FlyBaseID:FBgn0029877 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001005415.1 Gene:MARCHF2 / 51257 HGNCID:28038 Length:246 Species:Homo sapiens


Alignment Length:221 Identity:52/221 - (23%)
Similarity:85/221 - (38%) Gaps:52/221 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GAQPPQSAAAEAICSSQIVASAHGTPTASTAALEISSARQRMLRSHLQESLHSANESGNSCRICR 95
            |..|||..|                        :::|...|:| |.:..:|.:.:: |..||||.
Human    30 GLGPPQYVA------------------------QVTSRDGRLL-STVIRALDTPSD-GPFCRICH 68

  Fly    96 WNRNDMEIIKCPCNCKGSVGYIHLKCLKRWIMHRRDNRCEICNAVFNIAEERASLKQMI------ 154
            ...|. |.:..||.|.|::|.:|..||::|:.....:.||:|:..|.:.:....|.:.:      
Human    69 EGANG-ECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPR 132

  Fly   155 ---RTFCCGRCCGLIVKHLLFSASLMPLAHIILQQVLQCMDNMNQGSTDQLTVQEVFVASCALLT 216
               ||.||...|.|.:         .|||.|   ....|:    :|:.|.|.:.....|...:..
Human   133 TEKRTLCCDMVCFLFI---------TPLAAI---SGWLCL----RGAQDHLRLHSQLEAVGLIAL 181

  Fly   217 SSALFFHFFEFVTTRFMLIRNILSHW 242
            :.|||..:..:....|.....:.|.|
Human   182 TIALFTIYVLWTLVSFRYHCQLYSEW 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17717NP_572327.1 RINGv 91..138 CDD:128983 17/46 (37%)
MARCHF2NP_001005415.1 RING_CH-C4HC3_MARCH2 62..113 CDD:319722 18/51 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5397
Isobase 1 0.950 - 0 Normalized mean entropy S6026
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000792
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46065
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.