DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17717 and Marchf11

DIOPT Version :9

Sequence 1:NP_572327.1 Gene:CG17717 / 31592 FlyBaseID:FBgn0029877 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001095298.1 Gene:Marchf11 / 499558 RGDID:1559945 Length:398 Species:Rattus norvegicus


Alignment Length:130 Identity:37/130 - (28%)
Similarity:49/130 - (37%) Gaps:37/130 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ESAGNATMPLGAQPPQSAAAE-------------AICSSQIVASAHGTPTASTAALEISSARQRM 72
            |:|.....|  |:|...|..|             ::|||:  :|:.|           .|..|| 
  Rat   106 EAAAGKGSP--AEPEAGACGEGERRGTGDQPETRSVCSSR--SSSSG-----------GSGDQR- 154

  Fly    73 LRSHLQESLHSANESGNSCRICRWNRNDMEIIKCPCNCKGSVGYIHLKCLKRWIMHRRDNRCEIC 137
                   |.|........|:||.......|::. ||.|.|||.|.|..||.:||..|....||:|
  Rat   155 -------SGHQHQHHQPICKICFQGAEQGELLN-PCRCDGSVRYTHQLCLLKWISERGSWTCELC 211

  Fly   138  137
              Rat   212  211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17717NP_572327.1 RINGv 91..138 CDD:128983 20/47 (43%)
Marchf11NP_001095298.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..158 16/74 (22%)
RING_CH-C4HC3_MARCH4_like 165..215 CDD:319614 20/48 (42%)
YXXL motif 367..370
PDZ-binding 395..398
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.