powered by:
Protein Alignment CG17717 and CG1317
DIOPT Version :9
Sequence 1: | NP_572327.1 |
Gene: | CG17717 / 31592 |
FlyBaseID: | FBgn0029877 |
Length: | 266 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001163328.1 |
Gene: | CG1317 / 38300 |
FlyBaseID: | FBgn0035333 |
Length: | 988 |
Species: | Drosophila melanogaster |
Alignment Length: | 55 |
Identity: | 20/55 - (36%) |
Similarity: | 29/55 - (52%) |
Gaps: | 0/55 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 88 GNSCRICRWNRNDMEIIKCPCNCKGSVGYIHLKCLKRWIMHRRDNRCEICNAVFN 142
|:.||:||........:..||.|.||:.|||..||..|:.:.....||:|:..|:
Fly 7 GDICRVCRCEAQPDRPLFYPCICTGSIKYIHQDCLMLWMRYSHKEYCELCSYSFS 61
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG17717 | NP_572327.1 |
RINGv |
91..138 |
CDD:128983 |
17/46 (37%) |
CG1317 | NP_001163328.1 |
RINGv |
9..56 |
CDD:128983 |
17/46 (37%) |
DotA_TraY |
<737..913 |
CDD:275142 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5183 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R328 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.930 |
|
Return to query results.
Submit another query.