DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17717 and Marchf4

DIOPT Version :9

Sequence 1:NP_572327.1 Gene:CG17717 / 31592 FlyBaseID:FBgn0029877 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001038998.1 Gene:Marchf4 / 381270 MGIID:2683550 Length:409 Species:Mus musculus


Alignment Length:128 Identity:37/128 - (28%)
Similarity:55/128 - (42%) Gaps:14/128 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ESAGNATMPLGAQPPQSAAAEAICSSQIVASAHGTPTASTAALEISSARQRMLRSHLQE--SLHS 83
            |:.|..|.||...||...:.:        ....|..|...|:|..|::.....:...::  ||.|
Mouse    95 EAVGRETPPLPPPPPLPPSGD--------DDWDGPATGPPASLLSSASSDEFCKEKTEDCYSLGS 151

  Fly    84 ANESGNS---CRICRWNRNDMEIIKCPCNCKGSVGYIHLKCLKRWIMHRRDNRCEICNAVFNI 143
            :.:||..   ||||.......|::. ||.|.|||...|..||.:||..|....||:|...:::
Mouse   152 SLDSGMRTPLCRICFQGPEQGELLS-PCRCDGSVKCTHQPCLIKWISERGCWSCELCYYKYHV 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17717NP_572327.1 RINGv 91..138 CDD:128983 19/46 (41%)
Marchf4NP_001038998.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..133 11/45 (24%)
RING_CH-C4HC3_MARCH4_9 161..211 CDD:319725 20/50 (40%)
RING-CH finger (C4HC3-type) 162..207 CDD:319725 19/45 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 323..372
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..409
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.