DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17717 and CG13442

DIOPT Version :9

Sequence 1:NP_572327.1 Gene:CG17717 / 31592 FlyBaseID:FBgn0029877 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_611511.3 Gene:CG13442 / 37349 FlyBaseID:FBgn0034546 Length:425 Species:Drosophila melanogaster


Alignment Length:277 Identity:74/277 - (26%)
Similarity:113/277 - (40%) Gaps:69/277 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSHHQHVLSEAAALRLINGLESAGNATMPLGAQPPQSAAAEAICSSQIVASAHGTPTASTA-ALE 64
            :.|..|.|....|:     |.:|.:::...|  ||::||.::|.:.:     |....|:.. .|.
  Fly    98 LPHPSHPLVSTEAV-----LAAATSSSYSAG--PPKAAATDSIATLR-----HCVDGATQCNNLN 150

  Fly    65 ISSARQRMLRSHLQESLHSANESGNS-----CRICRWNRNDMEIIKCPCNCKGSVGYIHLKCLKR 124
            ..||               :|||..|     ||||. |.::.|.:..||.||||:.|:|:.||:.
  Fly   151 YESA---------------SNESMPSVGSLVCRICH-NADNPEQLVSPCLCKGSLTYVHVHCLEC 199

  Fly   125 WIMHRRDNRCEICNAVFNIAEERASLKQMIRTFCCGRCCGLIVKHLLFSASLMPLAHIILQ---Q 186
            ||...|...||:|...:|       .:|.:|..|      |....|.:|.::...|   ||   |
  Fly   200 WISTSRCTTCELCQFQYN-------TEQTLRYTC------LQSLRLWYSRAMSRRA---LQEDCQ 248

  Fly   187 VLQCMDNMNQGSTDQLTVQEVFVA-------SCALLTSSALFFHFFEFVTTRF----MLIRNILS 240
            :...:..:..|....|.|...:.|       ...|.|.|.:.|..|..:|..|    |||::.|:
  Fly   249 MFSLLTLVAFGIIGTLLVGIQYYALHTHSWGLSKLWTKSWMLFFLFMTITVYFANIYMLIKSQLT 313

  Fly   241 ---HWWMFGSTSDFELV 254
               .||.  |..|.:|:
  Fly   314 PWYRWWQ--SARDIKLI 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17717NP_572327.1 RINGv 91..138 CDD:128983 21/46 (46%)
CG13442NP_611511.3 AmyAc_family <36..>151 CDD:298606 15/64 (23%)
RINGv 166..213 CDD:128983 21/47 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000792
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46065
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X270
54.910

Return to query results.
Submit another query.