DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17717 and Marchf2

DIOPT Version :9

Sequence 1:NP_572327.1 Gene:CG17717 / 31592 FlyBaseID:FBgn0029877 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_038935345.1 Gene:Marchf2 / 362849 RGDID:1306395 Length:276 Species:Rattus norvegicus


Alignment Length:193 Identity:47/193 - (24%)
Similarity:81/193 - (41%) Gaps:37/193 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 CSSQ------IVASAHGTPTASTAALEISSARQRMLRSHLQESLHSANESGNSCRICRWNRNDME 102
            |||.      :.|:..|.|   ....:::|...|:| |.:..:|.:.::. ..||||....|...
  Rat    16 CSSSPAFSKVVEATGLGPP---QYVAQVTSRDGRLL-STVIRALDTPSDC-PFCRICHEGANGEN 75

  Fly   103 IIKCPCNCKGSVGYIHLKCLKRWIMHRRDNRCEICNAVFNIAEERASLKQMI---------RTFC 158
            ::. ||.|.|::|.:|..||::|:.....:.||:|:..|.:.:....|.:.:         ||.|
  Rat    76 LLS-PCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLC 139

  Fly   159 CGRCCGLIVKHLLFSASLMPLAHIILQQVLQCMDNMNQGSTDQLTVQEVFVASCALLTSSALF 221
            |...|.:.:         .|||.|   ....|:    :|:.|.|.:.....|...:..:.|||
  Rat   140 CDMVCFVFI---------TPLAAI---SGWLCL----RGAQDHLRLHSRLEAVGLIALTIALF 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17717NP_572327.1 RINGv 91..138 CDD:128983 16/46 (35%)
Marchf2XP_038935345.1 RING_CH-C4HC3_MARCH2 62..113 CDD:319722 17/51 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000792
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46065
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.