DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17717 and Marchf1

DIOPT Version :9

Sequence 1:NP_572327.1 Gene:CG17717 / 31592 FlyBaseID:FBgn0029877 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_017455664.2 Gene:Marchf1 / 361135 RGDID:1305148 Length:542 Species:Rattus norvegicus


Alignment Length:166 Identity:34/166 - (20%)
Similarity:74/166 - (44%) Gaps:33/166 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SQIVASAHGTPTASTAALEISSARQRMLRSHLQESLHSANESGNS----CRICRWNRNDMEIIKC 106
            ::|:|:|:|......:.|:::::.|:.         ..|::.|:.    ||||....::...:..
  Rat   293 TEILAAANGRGCVDGSGLQLNTSTQKS---------PGADDDGSENFEVCRICHCEGDEESPLIT 348

  Fly   107 PCNCKGSVGYIHLKCLKRWIMHRRDNRCEICNAVFNIAEERASLK-----QMI-----RTFCCGR 161
            ||.|.|::.::|..||.:||.......||:|...|.:..:...|:     ||.     :.||.  
  Rat   349 PCRCTGTLRFVHQSCLHQWIKSSDTRCCELCKYDFIMETKLKPLRKWEKLQMTTSERRKIFCS-- 411

  Fly   162 CCGLIVKHLLFSASLMPLAHIIL----QQVLQCMDN 193
                :..|::....::...::::    :::.|..||
  Rat   412 ----VTFHVIAVTCVVWSLYVLIDRTAEEIKQGNDN 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17717NP_572327.1 RINGv 91..138 CDD:128983 15/46 (33%)
Marchf1XP_017455664.2 RING_CH-C4HC3_MARCH1_like 332..383 CDD:319612 16/50 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X270
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.