DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17717 and Marchf8

DIOPT Version :9

Sequence 1:NP_572327.1 Gene:CG17717 / 31592 FlyBaseID:FBgn0029877 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_008761465.1 Gene:Marchf8 / 312656 RGDID:1309339 Length:568 Species:Rattus norvegicus


Alignment Length:206 Identity:50/206 - (24%)
Similarity:80/206 - (38%) Gaps:68/206 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSHHQH--VLSEAAALRLINGLESA-GNATMPLGAQPPQSAAAEAICSSQIV----------ASA 52
            :||.:|  :||.|.....::..|:. |:..:||   ..:.|..||...||.:          :||
  Rat   206 LSHSKHSPILSLATNHSAVSKREAGKGSVRIPL---LEEKADGEARLRSQRLLRYLFSLSRGSSA 267

  Fly    53 HGTP-------------TASTAAL-------------------EISSA--RQRMLR--------- 74
            ...|             ||.:::.                   :.|||  :.|:||         
  Rat   268 SSLPRFHELENHASRLHTAKSSSWLAGSMGFCSDEMGDDDVFEDASSAKLKNRVLRAPLCSVEKD 332

  Fly    75 ------SHLQES---LHSANESGNSCRICRWNRNDMEIIKCPCNCKGSVGYIHLKCLKRWIMHRR 130
                  |.|.|.   :...:.||::||||....:|...:..||:|.||:.::|..||::||....
  Rat   333 SDLDCPSVLSEKCTPISPVSTSGDACRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSD 397

  Fly   131 DNRCEICNAVF 141
            ...||:|...|
  Rat   398 TRCCELCKYEF 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17717NP_572327.1 RINGv 91..138 CDD:128983 17/46 (37%)
Marchf8XP_008761465.1 RING_CH-C4HC3_MARCH1_like 357..408 CDD:319612 18/50 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X270
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.