DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17717 and Marchf7

DIOPT Version :9

Sequence 1:NP_572327.1 Gene:CG17717 / 31592 FlyBaseID:FBgn0029877 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_038960759.1 Gene:Marchf7 / 311059 RGDID:1308993 Length:713 Species:Rattus norvegicus


Alignment Length:232 Identity:48/232 - (20%)
Similarity:89/232 - (38%) Gaps:45/232 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSEAAALRLINGLESAGNAT-------MPLG-----------------AQPP---QSAAAEAICS 45
            |..||:....:|  ::|||:       :|.|                 |.||   .:.......:
  Rat   455 LGAAASRPQASG--ASGNASASGSTPDLPQGGRNTGIAGILPGSLFRFAVPPALGSNLTDNVTIT 517

  Fly    46 SQIVASAHGTPTASTAALEISSARQRMLRSHLQESL----HSANESGNSCRICRW-NRNDMEIIK 105
            ..|:.|...:....:...:.:.:|.......::|||    ....|.|:.||||:. ..:...::.
  Rat   518 VDIIPSGWSSADGKSEKAKSAPSRDPEKLQKIKESLLLEDSDEEEEGDLCRICQMAAASSSNLLI 582

  Fly   106 CPCNCKGSVGYIHLKCLKRWIMHRRDN--------RCEICNAVFNIAEERASLKQMIRTFCCGRC 162
            .||.|.||:.|:|.:|:|:|:..:.::        .||:|.....:..|...:.::.|.....:.
  Rat   583 EPCKCTGSLQYVHQECMKKWLQAKINSGSSLEAVTTCELCKEKLQLNLEDFDIHELHRAHANEQA 647

  Fly   163 CGLIVKHLLFSASLMPLAHIILQQVLQCMDNMNQGST 199
            ....:...|:   |:.|.|:..|.....|.|..:.||
  Rat   648 EYEFISSGLY---LVVLLHLCEQSFSDMMGNTIEPST 681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17717NP_572327.1 RINGv 91..138 CDD:128983 16/55 (29%)
Marchf7XP_038960759.1 RING_CH-C4HC3_MARCH7 564..625 CDD:319726 18/60 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.