DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17717 and doa10

DIOPT Version :9

Sequence 1:NP_572327.1 Gene:CG17717 / 31592 FlyBaseID:FBgn0029877 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_596733.1 Gene:doa10 / 2539855 PomBaseID:SPBC14F5.07 Length:1242 Species:Schizosaccharomyces pombe


Alignment Length:200 Identity:49/200 - (24%)
Similarity:85/200 - (42%) Gaps:31/200 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 NESGNSCRICRWNRNDMEIIKCPCNCKGSVGYIHLKCLKRWIMHRRDNRCEICNAVFNIAEERA- 148
            |.....||:||........:..||.|.||:.|:|.:||..|:.|.:...||:|.|.|...:..: 
pombe     2 NADDEICRVCRCEGAPDSPLFHPCKCTGSIRYVHQECLVEWLGHSKKTHCELCKAKFEFTKVYSE 66

  Fly   149 SLKQMIR-TFCCGRCCGLIVKHLLFSASLMPLAH---IILQQVLQCMDNMNQGSTDQLTV---QE 206
            |:.:.|. |..|.:....:.:.::|...::....   ::|..:.:.:.|:|....|..|:   .:
pombe    67 SMPRTIPFTILCRKLASTLKQRVIFFTRVLLTFFCWTVLLPLIFKHVWNLNFKIGDTYTIHARNK 131

  Fly   207 VFVA--------SCALLTSS----ALFFHFFE-----FVTTRFMLIRNILSHWWMFGSTSDFELV 254
            .|.|        |.:.:|||    .|..:..|     ||.| |:||...|...|:..:.     |
pombe   132 TFTAPQKPGYFESISQITSSPRLNTLIANTAEGQVLTFVVT-FILITAFLVREWVLQNA-----V 190

  Fly   255 EIEDD 259
            ::.|:
pombe   191 QVADE 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17717NP_572327.1 RINGv 91..138 CDD:128983 17/46 (37%)
doa10NP_596733.1 SSM4 1..1239 CDD:227510 49/199 (25%)
RINGv 7..55 CDD:128983 17/47 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R328
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.