DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17717 and Marchf2

DIOPT Version :9

Sequence 1:NP_572327.1 Gene:CG17717 / 31592 FlyBaseID:FBgn0029877 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_663461.2 Gene:Marchf2 / 224703 MGIID:1925915 Length:287 Species:Mus musculus


Alignment Length:214 Identity:51/214 - (23%)
Similarity:87/214 - (40%) Gaps:37/214 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 CSSQ------IVASAHGTPTASTAALEISSARQRMLRSHLQESLHSANESGNSCRICRWNRNDME 102
            |||.      :.|:..|.|   ....:::|...|:| |.:..:|.|.::. ..||||....|...
Mouse    16 CSSSPAFSKVVEATGLGPP---QYVAQVTSRDGRLL-STVIRALDSQSDC-PFCRICHEGANGEN 75

  Fly   103 IIKCPCNCKGSVGYIHLKCLKRWIMHRRDNRCEICNAVFNIAEERASLKQMI---------RTFC 158
            ::. ||.|.|::|.:|..||::|:.....:.||:|:..|.:.:....|.:.:         ||.|
Mouse    76 LLS-PCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLC 139

  Fly   159 CGRCCGLIVKHLLFSASLMPLAHIILQQVLQCMDNMNQGSTDQLTVQEVFVASCALLTSSALFFH 223
            |...|.:.:         .|||.|   ....|:    :|:.|.|.:.....|...:..:.|||..
Mouse   140 CDMVCFVFI---------TPLAAI---SGWLCL----RGAQDHLRLHSRLEAVGLIALTIALFTI 188

  Fly   224 FFEFVTTRFMLIRNILSHW 242
            :..:....|.....:.|.|
Mouse   189 YVLWTLVSFRYHCQLYSEW 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17717NP_572327.1 RINGv 91..138 CDD:128983 16/46 (35%)
Marchf2NP_663461.2 RINGv 63..110 CDD:128983 16/47 (34%)
Vpu 173..>224 CDD:109608 7/35 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000792
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46065
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.