DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17717 and MARCHF8

DIOPT Version :9

Sequence 1:NP_572327.1 Gene:CG17717 / 31592 FlyBaseID:FBgn0029877 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001269795.1 Gene:MARCHF8 / 220972 HGNCID:23356 Length:573 Species:Homo sapiens


Alignment Length:160 Identity:41/160 - (25%)
Similarity:63/160 - (39%) Gaps:43/160 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HHQHVLSEAAALRLINGLESAGNATMPLGAQPPQSAAAEAICSSQIVASAHGTPTA---STAALE 64
            |..|.| |:.|.||.....|:|            .|.:...||.::     |....   ||:|  
Human   275 HRFHEL-ESCAARLHTAKSSSG------------LAGSMGFCSDEM-----GDDDVFEDSTSA-- 319

  Fly    65 ISSARQRMLRSHLQES------------------LHSANESGNSCRICRWNRNDMEIIKCPCNCK 111
              ..:.|:||:.|..:                  :...:.||:.||||....:|...:..||:|.
Human   320 --KLKSRVLRAPLCSTEKDSDLDCPSPFSEKLPPISPVSTSGDVCRICHCEGDDESPLITPCHCT 382

  Fly   112 GSVGYIHLKCLKRWIMHRRDNRCEICNAVF 141
            ||:.::|..||::||.......||:|...|
Human   383 GSLHFVHQACLQQWIKSSDTRCCELCKYEF 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17717NP_572327.1 RINGv 91..138 CDD:128983 17/46 (37%)
MARCHF8NP_001269795.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..72
RINGv 361..409 CDD:128983 17/47 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5397
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R328
SonicParanoid 1 1.000 - - X270
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.