powered by:
Protein Alignment CG17717 and Marchf11
DIOPT Version :9
Sequence 1: | NP_572327.1 |
Gene: | CG17717 / 31592 |
FlyBaseID: | FBgn0029877 |
Length: | 266 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_808265.2 |
Gene: | Marchf11 / 211147 |
MGIID: | 3608327 |
Length: | 400 |
Species: | Mus musculus |
Alignment Length: | 128 |
Identity: | 37/128 - (28%) |
Similarity: | 47/128 - (36%) |
Gaps: | 34/128 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 EAAALRLINGLESAGNATMPLGAQPPQSAAAEAICSSQIVASAHGTPTASTAALEISSARQRMLR 74
||.|.| |.....| |.|| ...::|||:..:|..|:.
Mouse 120 EAGACR-----EGERRGT---GDQP----ETRSVCSSRSSSSGGGSD------------------ 154
Fly 75 SHLQESLHSANESGNSCRICRWNRNDMEIIKCPCNCKGSVGYIHLKCLKRWIMHRRDNRCEIC 137
|.|.|........|:||.......|::. ||.|.|||.|.|..||.:||..|....||:|
Mouse 155 ---QRSGHQHQHHQPICKICFQGAEQGELLN-PCRCDGSVRYTHQLCLLKWISERGSWTCELC 213
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5183 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.