DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17717 and marc-4

DIOPT Version :9

Sequence 1:NP_572327.1 Gene:CG17717 / 31592 FlyBaseID:FBgn0029877 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001348646.1 Gene:marc-4 / 171616 WormBaseID:WBGene00016903 Length:317 Species:Caenorhabditis elegans


Alignment Length:170 Identity:42/170 - (24%)
Similarity:68/170 - (40%) Gaps:54/170 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 SLHSANESGNSCRICRWN---RNDMEIIKCPCNCKGSVGYIHLKCLKRWI-MHRR----DNRCEI 136
            ||.||  |.|.||||..:   |::..|  .||.|.|::.::|..|:.||: |..|    ..|||:
 Worm    71 SLQSA--SANMCRICHTSTSTRSNPLI--SPCRCSGTLLFVHKACVVRWLEMSTRKMVPSPRCEL 131

  Fly   137 CNAVFNIAEERASLKQMIRTFCCGRCCGLIVKHLLFSASLMPLAHIILQQVLQCMDNMNQGSTDQ 201
            |...:    .|.::.||         ..|.|.|:..|:.|:.:..:|...::             
 Worm   132 CGYDY----RRGNIFQM---------KSLHVPHVDRSSCLLNVLFLITVLIM------------- 170

  Fly   202 LTVQEVFVASCALLTSSALFFHFFEFVTTRFMLIRNILSH 241
                 :|   |...|        .:|:....:|.|.:.:|
 Worm   171 -----IF---CGYFT--------IQFIQENALLKRRLFAH 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17717NP_572327.1 RINGv 91..138 CDD:128983 19/54 (35%)
marc-4NP_001348646.1 RING_CH-C4HC3_MARCH 80..133 CDD:319409 19/54 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X270
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.