Sequence 1: | NP_572327.1 | Gene: | CG17717 / 31592 | FlyBaseID: | FBgn0029877 | Length: | 266 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005257152.2 | Gene: | MARCHF10 / 162333 | HGNCID: | 26655 | Length: | 863 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 46/205 - (22%) |
---|---|---|---|
Similarity: | 80/205 - (39%) | Gaps: | 58/205 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 46 SQIVASAHGTPTASTAALEISSARQRMLRSHLQESLHSANESGNSCRICR-WNRNDMEIIKCPCN 109
Fly 110 CKGSVGYIHLKCLKRWIMHRRDN--------RCEICNAVFNIAEERASLKQMIRTFCCGRCCGLI 166
Fly 167 V------------KHLLFSAS---------LMPLAHIILQQVLQCMD-NMNQGSTDQLTVQEVFV 209
Fly 210 ASCALLTSSA 219 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17717 | NP_572327.1 | RINGv | 91..138 | CDD:128983 | 16/55 (29%) |
MARCHF10 | XP_005257152.2 | RINGv | 697..753 | CDD:128983 | 17/68 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5183 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R328 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.930 |