DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17717 and MARCHF10

DIOPT Version :9

Sequence 1:NP_572327.1 Gene:CG17717 / 31592 FlyBaseID:FBgn0029877 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_005257152.2 Gene:MARCHF10 / 162333 HGNCID:26655 Length:863 Species:Homo sapiens


Alignment Length:205 Identity:46/205 - (22%)
Similarity:80/205 - (39%) Gaps:58/205 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SQIVASAHGTPTASTAALEISSARQRMLRSHLQESLHSANESGNSCRICR-WNRNDMEIIKCPCN 109
            |::.||.. |....|:.::....:.:.|:..|.|  ..:.|.|:.||||: ...:....:..||.
Human   655 SRMAASGF-TDEKETSKIKADPEKLKKLQESLLE--EDSEEEGDLCRICQIAGGSPSNPLLEPCG 716

  Fly   110 CKGSVGYIHLKCLKRWIMHRRDN--------RCEICNAVFNIAEERASLKQMIRTFCCGRCCGLI 166
            |.||:.::|.:|||:|:..:..:        .||:|             ||           ||:
Human   717 CVGSLQFVHQECLKKWLKVKITSGADLGAVKTCEMC-------------KQ-----------GLL 757

  Fly   167 V------------KHLLFSAS---------LMPLAHIILQQVLQCMD-NMNQGSTDQLTVQEVFV 209
            |            ||....|.         |:.|.|:..|:..:.|. |.||...:::...|:.:
Human   758 VDLGDFNMIEFYQKHQQSQAQNELMNSGLYLVLLLHLYEQRFAELMRLNHNQVERERIRSWEMEM 822

  Fly   210 ASCALLTSSA 219
            .:..|...|:
Human   823 KAAFLKARSS 832

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17717NP_572327.1 RINGv 91..138 CDD:128983 16/55 (29%)
MARCHF10XP_005257152.2 RINGv 697..753 CDD:128983 17/68 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R328
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.