powered by:
Protein Alignment CG17717 and MARCHF3
DIOPT Version :9
Sequence 1: | NP_572327.1 |
Gene: | CG17717 / 31592 |
FlyBaseID: | FBgn0029877 |
Length: | 266 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_011541430.1 |
Gene: | MARCHF3 / 115123 |
HGNCID: | 28728 |
Length: | 305 |
Species: | Homo sapiens |
Alignment Length: | 67 |
Identity: | 16/67 - (23%) |
Similarity: | 22/67 - (32%) |
Gaps: | 31/67 - (46%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 QPPQSAAAEAICSSQIVASAHGTPTASTAALEISSARQRMLRSHLQESLHSANESGNSCRICRWN 97
||.:.|| |:| |.:.:...|| :.|.|.:||. ..|.
Human 152 QPSEWAA--AVC--------HASFSQGRAA--------------------AVNSSADSCH-PEWL 185
Fly 98 RN 99
||
Human 186 RN 187
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG17717 | NP_572327.1 |
RINGv |
91..138 |
CDD:128983 |
4/9 (44%) |
MARCHF3 | XP_011541430.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5183 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
60 |
1.000 |
Inparanoid score |
I5397 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000792 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR46065 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
6 | 5.920 |
|
Return to query results.
Submit another query.