DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17717 and MARCHF3

DIOPT Version :9

Sequence 1:NP_572327.1 Gene:CG17717 / 31592 FlyBaseID:FBgn0029877 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_011541430.1 Gene:MARCHF3 / 115123 HGNCID:28728 Length:305 Species:Homo sapiens


Alignment Length:67 Identity:16/67 - (23%)
Similarity:22/67 - (32%) Gaps:31/67 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 QPPQSAAAEAICSSQIVASAHGTPTASTAALEISSARQRMLRSHLQESLHSANESGNSCRICRWN 97
            ||.:.||  |:|        |.:.:...||                    :.|.|.:||. ..|.
Human   152 QPSEWAA--AVC--------HASFSQGRAA--------------------AVNSSADSCH-PEWL 185

  Fly    98 RN 99
            ||
Human   186 RN 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17717NP_572327.1 RINGv 91..138 CDD:128983 4/9 (44%)
MARCHF3XP_011541430.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5397
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000792
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46065
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.