DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17717 and marchf1

DIOPT Version :9

Sequence 1:NP_572327.1 Gene:CG17717 / 31592 FlyBaseID:FBgn0029877 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_031751326.1 Gene:marchf1 / 100495418 XenbaseID:XB-GENE-486265 Length:519 Species:Xenopus tropicalis


Alignment Length:122 Identity:27/122 - (22%)
Similarity:55/122 - (45%) Gaps:9/122 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 HSANESGNSCRICRWNRNDMEIIKCPCNCKGSVGYIHLKCLKRWIMHRRDNRCEICNAVFNIAEE 146
            :..:|..:.||||....::...:..||.|.|::.::|..||.:||.......||:|...|.:..:
 Frog   300 NDVSEDLDVCRICHCEGDEENPLITPCLCTGTLRFVHQTCLHQWIKSSDTRCCELCKYDFVMETK 364

  Fly   147 RASLK-----QMIRTFCCGRCCGLIVKHLLFSASLMPLAHIILQQVLQCMDNMNQGS 198
            ...|:     ||.::......|. :..|::....:|...::::.:.   .:.:.|||
 Frog   365 LKPLRKWEKLQMTKSERSKIICS-VTFHIIALTCVMWSLYVLIDRT---AEEIKQGS 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17717NP_572327.1 RINGv 91..138 CDD:128983 15/46 (33%)
marchf1XP_031751326.1 RING_CH-C4HC3_MARCH1_like 308..359 CDD:319612 16/50 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X270
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.