powered by:
Protein Alignment CG17717 and marchf11
DIOPT Version :9
Sequence 1: | NP_572327.1 |
Gene: | CG17717 / 31592 |
FlyBaseID: | FBgn0029877 |
Length: | 266 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002933170.1 |
Gene: | marchf11 / 100487933 |
XenbaseID: | XB-GENE-982895 |
Length: | 287 |
Species: | Xenopus tropicalis |
Alignment Length: | 48 |
Identity: | 20/48 - (41%) |
Similarity: | 26/48 - (54%) |
Gaps: | 1/48 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 90 SCRICRWNRNDMEIIKCPCNCKGSVGYIHLKCLKRWIMHRRDNRCEIC 137
:|:||.......|::. ||.|.|||.|.|..||.:||..|....||:|
Frog 53 TCKICFQGPEQGELLN-PCRCDGSVRYTHQLCLLKWISERGSWTCELC 99
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.