powered by:
Protein Alignment CG17717 and march9
DIOPT Version :9
Sequence 1: | NP_572327.1 |
Gene: | CG17717 / 31592 |
FlyBaseID: | FBgn0029877 |
Length: | 266 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_001339845.1 |
Gene: | march9 / 100003493 |
ZFINID: | ZDB-GENE-081031-71 |
Length: | 342 |
Species: | Danio rerio |
Alignment Length: | 61 |
Identity: | 26/61 - (42%) |
Similarity: | 30/61 - (49%) |
Gaps: | 4/61 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 80 SLHSANESG---NSCRICRWNRNDMEIIKCPCNCKGSVGYIHLKCLKRWIMHRRDNRCEIC 137
||.|:..|| ..||||.......|::. ||.|.|||...|..||.|||..|....||:|
Zfish 92 SLTSSTGSGMRTPQCRICFQGPEQGELLS-PCRCDGSVRCTHQPCLIRWISERGSWSCELC 151
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG17717 | NP_572327.1 |
RINGv |
91..138 |
CDD:128983 |
21/47 (45%) |
march9 | XP_001339845.1 |
RINGv |
105..151 |
CDD:128983 |
20/46 (43%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5183 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.