DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17717 and march9

DIOPT Version :9

Sequence 1:NP_572327.1 Gene:CG17717 / 31592 FlyBaseID:FBgn0029877 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_001339845.1 Gene:march9 / 100003493 ZFINID:ZDB-GENE-081031-71 Length:342 Species:Danio rerio


Alignment Length:61 Identity:26/61 - (42%)
Similarity:30/61 - (49%) Gaps:4/61 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 SLHSANESG---NSCRICRWNRNDMEIIKCPCNCKGSVGYIHLKCLKRWIMHRRDNRCEIC 137
            ||.|:..||   ..||||.......|::. ||.|.|||...|..||.|||..|....||:|
Zfish    92 SLTSSTGSGMRTPQCRICFQGPEQGELLS-PCRCDGSVRCTHQPCLIRWISERGSWSCELC 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17717NP_572327.1 RINGv 91..138 CDD:128983 21/47 (45%)
march9XP_001339845.1 RINGv 105..151 CDD:128983 20/46 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.