powered by:
Protein Alignment CG17717 and march6
DIOPT Version :9
Sequence 1: | NP_572327.1 |
Gene: | CG17717 / 31592 |
FlyBaseID: | FBgn0029877 |
Length: | 266 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_005163506.1 |
Gene: | march6 / 100002072 |
ZFINID: | ZDB-GENE-070912-530 |
Length: | 936 |
Species: | Danio rerio |
Alignment Length: | 56 |
Identity: | 21/56 - (37%) |
Similarity: | 31/56 - (55%) |
Gaps: | 0/56 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 86 ESGNSCRICRWNRNDMEIIKCPCNCKGSVGYIHLKCLKRWIMHRRDNRCEICNAVF 141
|..:.||:||......:.:..||.|.||:.:||.:||.:|:.|.|...||:|...|
Zfish 5 EEADICRVCRSEGTQDKPLYHPCVCTGSIKFIHQECLVQWLKHSRKEYCELCKHRF 60
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG17717 | NP_572327.1 |
RINGv |
91..138 |
CDD:128983 |
18/46 (39%) |
march6 | XP_005163506.1 |
RINGv |
9..57 |
CDD:128983 |
18/47 (38%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R328 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.940 |
|
Return to query results.
Submit another query.